DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-H and CG10154

DIOPT Version :9

Sequence 1:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster


Alignment Length:244 Identity:54/244 - (22%)
Similarity:82/244 - (33%) Gaps:80/244 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CLVLLWSSRINADHFDECDGMDDGAFVQSWESCQSYVYCEGEESLKGDCEDGEYFDSEAGTCDIA 73
            ||....|.|:::..:|              .:|..||.|...:.:...|.||..:::....||..
  Fly   126 CLPTCESFRLSSFCYD--------------NTCTKYVLCYYGKPVLRQCHDGLQYNNATDRCDFP 176

  Fly    74 ANVSCFLDEVDEPSDPEPETDEEEEEIPATPRPTEPPIVETPTEVDIINIAPVVRPNCPISDDPG 138
            ..|.|                                                |..:|..:..|.
  Fly   177 EYVDC------------------------------------------------VANDCSATFQPE 193

  Fly   139 QVIFMASNNSCTNYYLCYHGHAMEMHCDNELYFNSLTGQCDYPDKVQCAFEDPRSHKCLPHM--- 200
            .:|::.|..||:.||:|.:||..|..|...|.:|.....||:...|.|.. |..:...||:.   
  Fly   194 DIIYLGSKASCSKYYVCSNGHPWEQQCAPGLAYNPSCKCCDFAKNVNCTI-DAVARNILPYSRTP 257

  Fly   201 ------------TEFFPHPDNCNYFYYCIKG-FLTLQQCP-FYYGWDIE 235
                        |.||||....:.:|||::| .:||...| .||...:|
  Fly   258 LRRADIKCPLMGTHFFPHKSRRDAYYYCVEGRGVTLDCTPGLYYDPKVE 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 9/50 (18%)
CBM_14 142..184 CDD:279884 14/41 (34%)
ChtBD2 203..240 CDD:214696 14/35 (40%)
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 12/63 (19%)
CBM_14 197..239 CDD:279884 14/41 (34%)
ChtBD2 263..311 CDD:214696 15/44 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.