DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-H and CG43896

DIOPT Version :9

Sequence 1:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001261732.1 Gene:CG43896 / 39360 FlyBaseID:FBgn0264488 Length:2113 Species:Drosophila melanogaster


Alignment Length:279 Identity:63/279 - (22%)
Similarity:89/279 - (31%) Gaps:95/279 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CDGMDDGAFVQSWESCQSYVYCEGEESLK-GDCEDGEYFDSEAGTCDIAANVSCFLDEVDEPSDP 89
            |:|::||..|...|.|:||..|..:.... ..|::|:||.|....|           .||.....
  Fly  1684 CNGLEDGKLVAHPEDCRSYYSCSSQNGTSLVQCDEGQYFHSLLSIC-----------RVDHGQCR 1737

  Fly    90 EPETDEEEEEIP---------------------------ATPRPTEPPIVETPTEVDIINIAPVV 127
            :....:|.|..|                           |.|       ||.|.:.....:..:.
  Fly  1738 KVSNQDETETAPRLCYGLHGVKLPHELYCNLYYACVKGLAIP-------VECPVQHQFNPVLSIC 1795

  Fly   128 RPNC----PISDDPGQV----------------IFMASNNSCTNYYLCYHGHAMEMHCDNELYFN 172
            .|..    |.|:  ||:                .|:|:...||.|::|..|.|....|....:|:
  Fly  1796 EPESQAVQPCSN--GQLDGNVSYVYRCGNLQDGTFLANRTDCTRYFICAGGVATAQRCAAGTFFD 1858

  Fly   173 SL-------TGQCDYPDKVQCAFEDPRSHKCLPHMT-------EFFPHPDNCNYFYYCIKGFL-- 221
            |.       .|.|...:.|....::|.:....|...       ...|.|.|||.||.|:.|.|  
  Fly  1859 SEQLLCLADDGSCPLVESVPDDDDNPNNQHVPPDPVVCEGKHGYLMPDPANCNNFYLCVSGKLRH 1923

  Fly   222 -----------TLQQCPFY 229
                       |||||..|
  Fly  1924 ELCYTDNFFNATLQQCQPY 1942

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 16/51 (31%)
CBM_14 142..184 CDD:279884 13/48 (27%)
ChtBD2 203..240 CDD:214696 16/40 (40%)
CG43896NP_001261732.1 CBM_14 96..147 CDD:279884
CBM_14 153..206 CDD:279884
CBM_14 211..257 CDD:279884
CBM_14 298..343 CDD:279884
CBM_14 354..395 CDD:279884
CBM_14 427..468 CDD:279884
ChtBD2 488..535 CDD:214696
CBM_14 544..593 CDD:279884
CBM_14 <1320..1361 CDD:279884
ChtBD2 1627..1675 CDD:214696
CBM_14 1684..1733 CDD:279884 17/59 (29%)
ChtBD2 1752..1797 CDD:214696 5/51 (10%)
CBM_14 1820..1868 CDD:279884 11/47 (23%)
CBM_14 1896..1939 CDD:279884 13/42 (31%)
ChtBD2 2046..2091 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.