DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-H and CG7248

DIOPT Version :9

Sequence 1:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_648530.1 Gene:CG7248 / 39356 FlyBaseID:FBgn0036229 Length:796 Species:Drosophila melanogaster


Alignment Length:242 Identity:66/242 - (27%)
Similarity:91/242 - (37%) Gaps:61/242 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKYLIHLCLVLLWSSRINADHFDECDGMDDGAFVQSWESCQSYVYCEGEESLKGDCEDGEYFDSE 66
            ||...|.|:|   ||:.|:.:   |:.:.:| |.:...:|.:|:.|....:....|.||:.|:|.
  Fly    44 SKRNSHECVV---SSQQNSTY---CESLSNG-FYEYPYNCSAYITCYDSCADLEYCPDGKLFNSP 101

  Fly    67 AGTCDIAANVSCFLDEVDEPSDPEPETDEEEEEIPATPRPTEPPIVETPTEVDIINIAPVVRPNC 131
            ...||....|.|      ||. |.|           ||.|||.|                  |..
  Fly   102 LQICDTPGAVDC------EPL-PYP-----------TPSPTESP------------------PEN 130

  Fly   132 PISDDPGQVIFMASNNSCTNYYLCYHGHAMEMHCDNELYFNSLTGQCDYPDKVQC----AFEDPR 192
            |........:..::.| |..:|||.:..:....|..|:.||.....||..|.|.|    ...||.
  Fly   131 PCLGTRNNTLLPSAEN-CNEFYLCVNDQSKVYRCPGEMLFNPDLNICDDKDNVWCYGDRTTPDPL 194

  Fly   193 S---------HKCL-PHMTEFFPHPDNCNYFYYC--IKGFLTLQQCP 227
            .         .||. .....|||.|:||..:|||  .|.: |:..||
  Fly   195 DTTTPAEESFTKCEDQEKGTFFPDPENCQQYYYCWGNKSY-TILPCP 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 13/50 (26%)
CBM_14 142..184 CDD:279884 12/41 (29%)
ChtBD2 203..240 CDD:214696 13/27 (48%)
CG7248NP_648530.1 CBM_14 62..113 CDD:279884 14/51 (27%)
CBM_14 136..182 CDD:279884 12/46 (26%)
CBM_14 207..261 CDD:279884 14/35 (40%)
CBM_14 293..347 CDD:279884
CBM_14 367..421 CDD:279884
CBM_14 470..522 CDD:279884
CBM_14 544..597 CDD:279884
CBM_14 630..678 CDD:279884
CBM_14 710..758 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.