DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-H and CG5897

DIOPT Version :9

Sequence 1:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001356901.1 Gene:CG5897 / 39346 FlyBaseID:FBgn0036220 Length:343 Species:Drosophila melanogaster


Alignment Length:332 Identity:69/332 - (20%)
Similarity:105/332 - (31%) Gaps:103/332 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 HLCLVLLWSSRINADHF-DECDGMDDGAFVQSWESCQSYVYCEGEESL-KGDCEDGEYFDSEAGT 69
            |||::|...:.|..... |:|.......::.....||::.||:..:.: :..|.:|..:....||
  Fly     9 HLCVILAIVAEIRGFSMEDKCKLWAGTGYIGDPSDCQAWGYCQDNKLIDRRSCTEGLLYSFRDGT 73

  Fly    70 CDIAANVSCFLDEVDEPSDPEPETDEEEEEIPATPRPTEPPIVETPTEVDIINIAPVVRPNCPIS 134
            |..|::..|               ..:..||.|:..|..  .|..|.:....       ..|...
  Fly    74 CKRASDTIC---------------HSQLSEICASLEPWN--YVANPADCRRF-------VKCADL 114

  Fly   135 DDP-------GQVI---------------------------FMASNNSCTNYYLCYHGHAMEMHC 165
            |||       |||.                           |:....||..||.|::|....::|
  Fly   115 DDPTWGDCGVGQVFSNKKQTCLEEVAGCPQDNICSHMKDGSFVGDPKSCQIYYKCHNGFGTMLNC 179

  Fly   166 DNELYFNSLTGQCDYPDKVQCAFED------PRS--HK-CLPHM------TEFFPHPDNCNYFYY 215
            ....|||..||.|.......|:.:|      |.|  |. |..:.      .:..|....|..:|.
  Fly   180 SVGRYFNRKTGNCQSWMPHYCSKDDEDNILTPPSTDHNICSKYYQRDRDGVQLLPDLMTCYGYYS 244

  Fly   216 CIKGFLT--LQQCPF--YYGWDIER------RSCV--------QIGVAK----------CYGNSR 252
            |...|..  ...||:  ::.|..:|      .||.        |:.||.          |..|..
  Fly   245 CTSQFDVGKWSSCPWGLHFEWWSQRCGSPKDNSCSYDRCANRNQLMVATINTGCREFTICQDNRS 309

  Fly   253 RIGRKAP 259
            :..:|.|
  Fly   310 KSSQKCP 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 11/51 (22%)
CBM_14 142..184 CDD:279884 14/41 (34%)
ChtBD2 203..240 CDD:214696 10/46 (22%)
CG5897NP_001356901.1 ChtBD2 146..192 CDD:214696 13/45 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.