DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-H and CG13312

DIOPT Version :9

Sequence 1:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_648260.1 Gene:CG13312 / 39010 FlyBaseID:FBgn0035931 Length:342 Species:Drosophila melanogaster


Alignment Length:160 Identity:32/160 - (20%)
Similarity:50/160 - (31%) Gaps:57/160 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SWESCQSYVYC---EGEESLKGD---CEDGEYFDSEA--------GTCDIAANVSCFLDEVDEPS 87
            ::.:|:.|:||   :|  |..|.   |....||||.:        .||...|..|.........|
  Fly   199 AYTTCRQYIYCTLVDG--SWIGQTYTCPGSMYFDSASEMCVSTMPSTCSTTATTSSTTTAAPTTS 261

  Fly    88 DPEPETDEEEEEIPATPRPTEPPIVETPTEVDIINIAPVVRPNCPISDDPGQVIFMASNNSCTNY 152
            :||......:.                             ....|:..|        ::.:|..|
  Fly   262 NPEAYCQAMQS-----------------------------AGYYPVGTD--------ASTTCHQY 289

  Fly   153 YLCY-HGHAM--EMH-CDNELYFNSLTGQC 178
            ..|: :|...  .|: |...||:||.:..|
  Fly   290 IDCFLNGGTWGGNMYTCPGSLYYNSASRTC 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 15/53 (28%)
CBM_14 142..184 CDD:279884 11/41 (27%)
ChtBD2 203..240 CDD:214696
CG13312NP_648260.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.