DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-H and CG33985

DIOPT Version :9

Sequence 1:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster


Alignment Length:259 Identity:99/259 - (38%)
Similarity:146/259 - (56%) Gaps:27/259 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLWSSRINADHFDECDGMDDGAFVQSWESCQSYVYCEGEESLKGDCEDGEYFDSEAGTCDIAANV 76
            ||:.:..:||.||||:..::.:||.|.:||..|::|.|:||..|:|||||||..:...|:...::
  Fly    14 LLFLATSHADVFDECNDGNNLSFVTSPKSCAHYIFCNGDESYDGECEDGEYFSQDMEMCEPMGDI 78

  Fly    77 SCFL-DEVDEPSDPEPETDEEEEEIPATPRPTEPPIVETPTEVDIINIAPVVRPN---------- 130
            .|.. .||..    |..||....||.:........::.|.....::.:.|.|..:          
  Fly    79 DCRTGSEVQR----ENTTDSSSTEITSESSTISTVVITTLAPSAVVTLRPSVNQSGASSTTSVSP 139

  Fly   131 ---------CPISDDPGQVIFMASNNSCTNYYLCYHGHAMEMHCDNELYFNSLTGQCDYPDKVQC 186
                     ||..|:..::..:.:.|||::||:||.|.|:.|.|...|:||||||:||:|:.|:|
  Fly   140 AIEIIVTNVCPQLDNQSRIALLPNQNSCSDYYICYRGVALPMSCATSLHFNSLTGKCDHPENVRC 204

  Fly   187 --AFEDPRSHKCLPHMTEFFPHPDNCNYFYYCIKGFLTLQQCPFYYGWDIERRSCVQIGVAKCY 248
              ...:|| .:|..|:.:.:||.|||||||.|..|:|.:|||||:||||.|:||||.:|.||||
  Fly   205 LAMTYNPR-EQCKRHVIDVYPHSDNCNYFYQCRSGYLMVQQCPFFYGWDYEKRSCVALGQAKCY 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 20/50 (40%)
CBM_14 142..184 CDD:279884 21/41 (51%)
ChtBD2 203..240 CDD:214696 24/36 (67%)
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884 20/45 (44%)
CBM_14 160..202 CDD:279884 21/41 (51%)
ChtBD2 215..259 CDD:214696 26/43 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470257
Domainoid 1 1.000 56 1.000 Domainoid score I18123
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50162
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 1 1.000 - - FOG0007617
OrthoInspector 1 1.000 - - otm49549
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.