DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-H and Cht7

DIOPT Version :10

Sequence 1:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster


Alignment Length:187 Identity:42/187 - (22%)
Similarity:63/187 - (33%) Gaps:45/187 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLWSSRIN---ADHFDECDGMDDGAFVQS---WESCQSY----VYCEGEESLKGDCEDGEYFDSE 66
            |:|.|...   |...::..|.||...:::   |...|.:    |:....:...|.|..|:|    
  Fly   849 LVWDSEQQVPFAYRGNQWVGFDDERSLKTKTEWLKEQGFGGIMVWSIDMDDFSGRCGSGKY---- 909

  Fly    67 AGTCDIAANVSCFLDEVDEPSDPEPETDEE---EEEIPATPRPTEPPIVETPTEVDIINIAPVVR 128
              ....|.|        ||..|.:.|.:.:   |...|.....|:.|...|..|.|         
  Fly   910 --PLLTALN--------DELKDYKVELEYDGPYESHGPRGAYTTKDPHDVTCAEED--------- 955

  Fly   129 PNCPISDDPGQVIFMASNNSCTNYYLCYHGHAMEMHCDNELYFNSLTGQCDYPDKVQ 185
                     |.:.:......||:||:|.......|.|...|.||.....||:|:.|:
  Fly   956 ---------GHISYHKDWADCTHYYMCEGERKHHMPCPANLVFNPQENVCDWPENVE 1003

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-HNP_001034020.1 CBM_14 26..77 CDD:426342 12/57 (21%)
CBM_14 142..184 CDD:426342 13/41 (32%)
ChtBD2 203..240 CDD:214696
Cht7NP_647768.3 GH18_chitolectin_chitotriosidase 125..491 CDD:119351
GH18_chitolectin_chitotriosidase 560..919 CDD:119351 17/83 (20%)
CBM_14 951..1005 CDD:426342 17/71 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.