DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-H and Peritrophin-A

DIOPT Version :9

Sequence 1:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster


Alignment Length:250 Identity:51/250 - (20%)
Similarity:80/250 - (32%) Gaps:72/250 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKYLIHLCLVLLWSSRINADH-----FDECDGMDDGAFVQSW---ESCQSYVYCEGEESLKGDC 57
            |.::.:...|:|.|   |...|     ..||   .:...||::   |:|..:..|.........|
  Fly     1 MQRFQVCSVLILAW---IACGHALAVGSPEC---PEKYGVQAYAHTENCDQFFLCTNGTLTLETC 59

  Fly    58 EDGEYFDSEAGT---CDIAANVSCFLDEVDEPSDPEPETDEEEEEIPATPRPTEPPIVETPTEVD 119
            |:|..||.:...   |:....|.|                        ..|..:|          
  Fly    60 ENGLLFDGKGAVHNHCNYNWAVDC------------------------KGRQWDP---------- 90

  Fly   120 IINIAPVVRPNCPISDDPGQVIFMASNNSCTNYYLCYHGHAMEMHCDNELYFNSLTGQCDYPDKV 184
                .|:..|.|.....    ::..|.:..|.|..|.||...|..||..|.::.....|::||::
  Fly    91 ----TPISTPACEYQFG----LYAVSKDCSTTYIKCAHGEPHEQDCDAGLAYDERIHGCNWPDQL 147

  Fly   185 --QCAFEDPRSHKCLPHM------TEFFPHP-----DNCNYFYYCIKGFLTLQQC 226
              .|..|.....||...:      ..|:|.|     .:|:....|::|...|..|
  Fly   148 LEHCNPEAVVGFKCPTKVDPNSVAARFWPFPRFPVAGDCHRLITCVEGHPRLISC 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 12/56 (21%)
CBM_14 142..184 CDD:279884 13/41 (32%)
ChtBD2 203..240 CDD:214696 7/28 (25%)
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:279884 10/46 (22%)
CBM_14 103..147 CDD:279884 13/47 (28%)
ChtBD2 179..218 CDD:214696 4/23 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.