DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-H and CG31077

DIOPT Version :9

Sequence 1:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_733185.2 Gene:CG31077 / 318583 FlyBaseID:FBgn0051077 Length:988 Species:Drosophila melanogaster


Alignment Length:241 Identity:51/241 - (21%)
Similarity:83/241 - (34%) Gaps:62/241 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FDECDGMD-----------------DGAFVQSWESCQSYVYCEGEESLKGDCEDGEYFDSEAGTC 70
            |...||:|                 :|....:.:.|..|:.|.|..:.:..|:.|.||:.....|
  Fly   622 FTTLDGVDNLDINTGTCVYNNTLFIEGIREVNPQDCAGYIECFGGVAKELKCDSGRYFNETQRNC 686

  Fly    71 DIAANVSCFLDEVDEPSDPEPETDEEEEEIPATPRPTEPPIVETPTEVDIINIAPVVRPNCPISD 135
            .:.      :||:...||.....|                 ::|.||         ..||...|.
  Fly   687 SVD------VDEICLKSDKTIVLD-----------------LQTTTE---------STPNFTTSV 719

  Fly   136 DP------GQVIFMASNNSCTNYYLCYHGHAMEMHCDNELYFNSLTGQCDYPDKVQCAFEDPRSH 194
            ||      ||:.....|  |..:..|..|...|..|.:..::||.:.:|....:..|.   ....
  Fly   720 DPFAKCRDGQLRLDPKN--CAGFLKCVDGELKEEMCPSGFFYNSTSSKCMVDIRATCV---TNIK 779

  Fly   195 KCLPHMTEFFPHPDNCNYFYYCIKGFLTLQQCPFYYGWDIERRSCV 240
            .|:..:.|  ..|:||..:..||:|.:....||....:::..|.|:
  Fly   780 YCIEGVRE--EDPNNCAGYRQCIRGLVQNLNCPLGQYFNVAERDCL 823

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 13/67 (19%)
CBM_14 142..184 CDD:279884 9/41 (22%)
ChtBD2 203..240 CDD:214696 9/36 (25%)
CG31077NP_733185.2 CBM_14 43..81 CDD:279884
ChtBD2 <212..245 CDD:214696
CBM_14 267..308 CDD:279884
CBM_14 439..472 CDD:279884
CBM_14 733..769 CDD:279884 9/37 (24%)
CBM_14 881..914 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.