DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-H and cbd-1

DIOPT Version :9

Sequence 1:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_502145.2 Gene:cbd-1 / 178061 WormBaseID:WBGene00010351 Length:1319 Species:Caenorhabditis elegans


Alignment Length:278 Identity:63/278 - (22%)
Similarity:96/278 - (34%) Gaps:86/278 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ADHFDECDGMDDGAFVQSWESC------------QSYVYCEGEESLKGDCEDGEYFDSEAGTCDI 72
            ||:..|.:..||   |:..:.|            ::|:.|....:::..|..|:.|||.:..|  
 Worm  1014 ADNDSEDEEEDD---VEHDQKCTVGSRTPVGFCVRTYLECTDAGNVEKLCRIGKLFDSHSNRC-- 1073

  Fly    73 AANVSCFLDEVDEPSDPEPETDEEEEEIPATPRPTEPPIVE-TPTEVD---IINIAP-------- 125
            ...:.|         ..|...|..::.|..||.|.:|...| ....||   :.:|..        
 Worm  1074 VPRIGC---------GKEAIRDAIKDMIATTPAPAQPKQFEGRCAHVDGEAVFSIGVCSSKYLRC 1129

  Fly   126 -----------------------VVRPN---CPISDDPGQVIFMASNN----------------- 147
                                   :||.:   |.:..:|....:..||:                 
 Worm  1130 SYGASKLQQCSEDRVFSNDKLECIVRESVSACTVPKNPSIKKYYTSNDQSAFCDGKEDGLYRNER 1194

  Fly   148 SCTNYYLCYHGHAMEMH--CDNELYFNSLTGQCDYPDKVQ-CAFEDPRSHKCLPHMTEFFPHPDN 209
            .|:....|:.|...| |  |.:.|.||.|||:||||.||. |......:.:|..| ..|....:|
 Worm  1195 DCSAILQCFGGELFE-HPSCQSSLAFNQLTGKCDYPQKVSGCENHGQTNGECSEH-GSFIADANN 1257

  Fly   210 CNYFYYCIKGFLTLQQCP 227
            |..||.|:.|...:..||
 Worm  1258 CEVFYRCVWGRKVVMTCP 1275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 12/62 (19%)
CBM_14 142..184 CDD:279884 18/60 (30%)
ChtBD2 203..240 CDD:214696 9/25 (36%)
cbd-1NP_502145.2 ChtBD2 97..141 CDD:214696
ChtBD2 191..237 CDD:214696
CBM_14 692..743 CDD:307643
CBM_14 785..836 CDD:307643
CBM_14 1108..1161 CDD:307643 5/52 (10%)
CBM_14 1182..1235 CDD:307643 18/53 (34%)
CBM_14 1251..1296 CDD:307643 9/25 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I8249
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.