DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-H and cpg-2

DIOPT Version :9

Sequence 1:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_498551.3 Gene:cpg-2 / 175991 WormBaseID:WBGene00015102 Length:524 Species:Caenorhabditis elegans


Alignment Length:189 Identity:43/189 - (22%)
Similarity:60/189 - (31%) Gaps:51/189 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ECDGM--------DDGAFVQSWESC-QSYVYCEGEESLKGDCEDGEYFDSEAGTCDIAANVSCFL 80
            ||.|:        :||.|  |:..| .|:..|....::...|..|..|......||..:|||   
 Worm   298 ECAGLPTPQPTCEEDGYF--SFGQCSSSFTACTNGRAIVMFCPAGLKFSESTVRCDYESNVS--- 357

  Fly    81 DEVDEPSDPEPETDEEEEEIPATPRPTEPPIVETPTEVDIINIAPVVRPNCPISDDPGQVIFMAS 145
             |..|.|.        ||...|:...:.....|...|..              .:..|:...:..
 Worm   358 -ECQETSG--------EESGEASGEQSGEGSGEASGEAS--------------GESSGEGSGVEE 399

  Fly   146 NNSCT-------------NYYLCYHGHAMEMHCDNELYFNSLTGQCDYPD-KVQCAFED 190
            .|.|.             ....|.:||.....|.:.|.||..:..||||. .::|..||
 Worm   400 QNQCVGLDNGLHAIGCSPRVLSCQNGHVDIFECPSSLVFNDQSLICDYPQTSLKCLIED 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 15/59 (25%)
CBM_14 142..184 CDD:279884 13/55 (24%)
ChtBD2 203..240 CDD:214696
cpg-2NP_498551.3 CBM_14 24..76 CDD:279884
CBM_14 138..190 CDD:279884
ChtBD2 245..293 CDD:214696
CBM_14 311..359 CDD:279884 15/53 (28%)
CBM_14 403..454 CDD:279884 12/50 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.