DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-H and LOC108179232

DIOPT Version :9

Sequence 1:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_021322084.1 Gene:LOC108179232 / 108179232 -ID:- Length:185 Species:Danio rerio


Alignment Length:91 Identity:28/91 - (30%)
Similarity:37/91 - (40%) Gaps:13/91 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 SNNSCTNYYLCYHGHAMEMHCDNELYFNSLTG--QC-DYPDKVQC-AFED----PRSHKCLPHMT 201
            :.|.|...|.|..|.|..:||.:..:.|| ||  :| |.|....| ..||    |:.|.|:....
Zfish    75 TGNRCPTRYYCPQGCASPLHCPDGTHSNS-TGSAECSDCPTGWLCLEGEDLQLCPKGHYCVGGTV 138

  Fly   202 E-FFPHPDNCNYFYYCIKGFLTLQQC 226
            | ..|.|...   |....|...::||
Zfish   139 EDILPCPPGT---YSPKAGQSQVEQC 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884
CBM_14 142..184 CDD:279884 15/41 (37%)
ChtBD2 203..240 CDD:214696 6/24 (25%)
LOC108179232XP_021322084.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.