DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-H and Gm30500

DIOPT Version :9

Sequence 1:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_017171830.1 Gene:Gm30500 / 102632425 MGIID:5589659 Length:614 Species:Mus musculus


Alignment Length:252 Identity:59/252 - (23%)
Similarity:76/252 - (30%) Gaps:94/252 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 CQSYVYCEGEESL---KGDCEDGEY----------FDSEAGT-----CD-IAANVSCFLDEVDEP 86
            |....|| |:|:|   .|.|:.|.|          ||.:..|     |. .|....|........
Mouse   265 CPPGHYC-GQENLTKPSGPCDAGWYCVSAAWNARPFDLDNYTSTNCLCPATATGGKCPAGSYCPE 328

  Fly    87 SDPEPETDEEEEEIPAT----------PRPTEPPIV--------ETPTEVDIINIAPVVRPNCPI 133
            ..|||        ||.|          |.||.|...        |:|..||.:...|     || 
Mouse   329 GSPEP--------IPCTPGSFCATSGLPTPTGPCQAGYFCIGGSESPAPVDEVTGGP-----CP- 379

  Fly   134 SDDPGQVIFMASN----------------------NSCTNYYLCYHG--HAMEMHCDNELYFNSL 174
               ||....:||:                      .||.:.:.|...  .|....|....|.:|.
Mouse   380 ---PGSYCPVASHKPTPCPVGTFSSLPEQTTSSTCRSCPSGFYCKEAGLQAPSGWCPAGYYCDSS 441

  Fly   175 TGQCD----YPDKVQCAFEDPRSHKCLPHMTEFFPHPDNCNY-FYYCIKGFLTLQQC 226
            ||...    ||    |    ||.:.|....|:...|  :|.. .|...||..::.:|
Mouse   442 TGPVQDFSLYP----C----PRGYYCPVGTTKAMYH--SCPVGTYGPRKGLTSITEC 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 15/54 (28%)
CBM_14 142..184 CDD:279884 13/69 (19%)
ChtBD2 203..240 CDD:214696 6/25 (24%)
Gm30500XP_017171830.1 TNFRSF 394..518 CDD:389949 22/105 (21%)
CRD1 394..411 CDD:276900 0/16 (0%)
CRD2 414..451 CDD:276900 8/36 (22%)
CRD3 453..506 CDD:276900 11/42 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.