DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-H and CG42728

DIOPT Version :9

Sequence 1:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001189111.1 Gene:CG42728 / 10178859 FlyBaseID:FBgn0261681 Length:156 Species:Drosophila melanogaster


Alignment Length:237 Identity:52/237 - (21%)
Similarity:85/237 - (35%) Gaps:98/237 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LIHLCLVLLWSSRINADHFDECDGMDDGAFVQSWES-CQ-SYVYCEGEESLKGDCEDGEYFDSEA 67
            :::..::::|.  ||..:..||.|.:  .|:.:..| |. |.:.|.|:.|:         |.::.
  Fly    12 IVYGLILVVWG--INGLNIPECSGQN--GFINNTRSNCNYSLINCSGQNSM---------FCTDN 63

  Fly    68 GTCDIAANVSCFLDEVDEPSDPEPETDEEEEEIPATPRPTEPPIVETPTEVDIINIAPVVRPNCP 132
            .||:  ||.:|        ||..|     .:...|.|..|.|.:|.|.:    ..::|       
  Fly    64 TTCN--ANFTC--------SDILP-----VDNSTALPISTTPNVVTTAS----TTVSP------- 102

  Fly   133 ISDDPGQVIFMASNNSCTNYYLCYHGHAMEMHCDNELYFNSLTGQCDYPDKVQCAFEDPRSHKCL 197
                                                                    .|.| .:|.
  Fly   103 --------------------------------------------------------SDIR-RECR 110

  Fly   198 PHMTEFFPHPDNCNYFYYCIKGFLTLQQCPFYYGWDIERRSC 239
            ..:|:.|.:|.||||||||:.|||.::|||..|.:|.:..:|
  Fly   111 QGVTKRFSYPQNCNYFYYCVDGFLLVEQCPIGYAFDPQTGAC 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 14/52 (27%)
CBM_14 142..184 CDD:279884 0/41 (0%)
ChtBD2 203..240 CDD:214696 19/37 (51%)
CG42728NP_001189111.1 CBM_14 117..152 CDD:279884 18/34 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007617
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.