DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-H and si:ch211-286b4.4

DIOPT Version :9

Sequence 1:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_021322239.1 Gene:si:ch211-286b4.4 / 100005359 ZFINID:ZDB-GENE-131127-605 Length:2996 Species:Danio rerio


Alignment Length:289 Identity:61/289 - (21%)
Similarity:89/289 - (30%) Gaps:100/289 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ADHFDEC-----DGMDDGAFVQSWESCQSYVYC--EGEESLKGDCEDGEYFDSEAGTCDIAANVS 77
            |.|.:.|     ..::..|.|:..:||....||  .|..|..|.|..|.|       |...::  
Zfish   164 ASHMEPCPLGTFGSLEGAASVEMCQSCTPGHYCAESGLTSPSGPCSPGYY-------CVQGSH-- 219

  Fly    78 CFLDEVDEPSDPEPETDEEEEEIPATPRP-------TEPPIVETPTEV--------DII---NIA 124
                                     ||.|       .|.|:..:..::        ||.   :..
Zfish   220 -------------------------TPAPQYYNNTVCEEPVGHSAEDIYSHLQFIGDICPAGHYC 259

  Fly   125 PV--VRPN-CPISDDPGQ--VIFMASNNSCTNYYLC--YHGHAMEMHCDNELYF--NSLTG---- 176
            |:  |||. ||.....||  .:.......||:.|.|  :...:.|:.|....:.  .|.||    
Zfish   260 PIGSVRPEPCPPGFFQGQRGAVSETDCQPCTSGYYCPDWGQSSAELLCPEGSFCPPGSPTGHQPE 324

  Fly   177 -QCDYPDKVQCAFEDPRSHKCLPHMTEFFPHPDNCN---YFYYCIKGFLTLQQCPFYYGWDIE-- 235
             ||  |....|.:.......|||...:..|...:|.   ..:||::|..:...||......||  
Zfish   325 RQC--PSGHACPYGSVEPAICLPGTYQPLPSQPSCQPCPSGFYCLEGCTSPLPCPAGTASVIEGL 387

  Fly   236 --RRSCVQIGVAKCYGNSRRIGRKAPLPP 262
              :|.|                  :|.||
Zfish   388 QSQRDC------------------SPCPP 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 14/57 (25%)
CBM_14 142..184 CDD:279884 12/50 (24%)
ChtBD2 203..240 CDD:214696 10/43 (23%)
si:ch211-286b4.4XP_021322239.1 Ephrin_rec_like <945..983 CDD:311571
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.