DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7945 and BAG2

DIOPT Version :9

Sequence 1:NP_730051.1 Gene:CG7945 / 39679 FlyBaseID:FBgn0036505 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_004273.1 Gene:BAG2 / 9532 HGNCID:938 Length:211 Species:Homo sapiens


Alignment Length:176 Identity:64/176 - (36%)
Similarity:102/176 - (57%) Gaps:17/176 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 SRALDRPFNASERFVTILDSLDARVEKLRKDALNLQEKKDYLLMSMDLIKSNEMMQNMSEAEREE 142
            |...||    |.|.:..||.|:.|||.||:.|..::::|:.||..:..|::::.|:.:|:.||||
Human    19 SSMADR----SSRLLESLDQLELRVEALREAATAVEQEKEILLEMIHSIQNSQDMRQISDGEREE 79

  Fly   143 IILYLQRVSSRLATVELRVRTVRDNSQEDSLSQINVLIDSMI-KMGDPVIGRQRCQFYLNACCSS 206
            :.|...|:..|..|||:.|.|:|:..|::||.....:||.:: |..|.:...:.....|.:.|||
Human    80 LNLTANRLMGRTLTVEVSVETIRNPQQQESLKHATRIIDEVVNKFLDDLGNAKSHLMSLYSACSS 144

  Fly   207 SMDPSGHMDTVPEADVGPVDKKFESVLLGCTLDDQKNIKKRLQALM 252
            .         ||.   ||||:||:|:::||.|:|||.||:||:.|:
Human   145 E---------VPH---GPVDQKFQSIVIGCALEDQKKIKRRLETLL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7945NP_730051.1 None
BAG2NP_004273.1 BAG 109..189 CDD:214591 30/82 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158961
Domainoid 1 1.000 103 1.000 Domainoid score I6760
eggNOG 1 0.900 - - E1_KOG3633
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31233
Inparanoid 1 1.050 104 1.000 Inparanoid score I4963
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46876
OrthoDB 1 1.010 - - D1268987at2759
OrthoFinder 1 1.000 - - FOG0006323
OrthoInspector 1 1.000 - - oto89540
orthoMCL 1 0.900 - - OOG6_109431
Panther 1 1.100 - - LDO PTHR12334
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3579
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.890

Return to query results.
Submit another query.