DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7945 and bag2

DIOPT Version :9

Sequence 1:NP_730051.1 Gene:CG7945 / 39679 FlyBaseID:FBgn0036505 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001006729.1 Gene:bag2 / 448388 XenbaseID:XB-GENE-966120 Length:213 Species:Xenopus tropicalis


Alignment Length:176 Identity:56/176 - (31%)
Similarity:101/176 - (57%) Gaps:15/176 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 SERFVTILDSLDARVEKLRKDALNLQEKKDYLLMSMDLIKSNEMMQNMSEAEREEIILYLQRVSS 152
            |...:.|||.|:.||:..|..|..|:.:::.|:..:..::::..::.:|:.||||:::..:|:..
 Frog    30 SNHLLEILDDLEVRVQAFRDAASALELERESLIEKIHSVQNSHDIRTISDGEREELLVTAERLMG 94

  Fly   153 RLATVELRVRTVRDNSQEDSLSQINVLIDSMIK--MGDPVIGRQRCQFYLNACCSSSMDPSGHMD 215
            |..||.:.|.|:|:..||.||.|.:::||.::|  |.:...||::......||.|          
 Frog    95 RTLTVAVAVETIRNPQQESSLQQASMIIDEILKKVMDNLENGRKQLMGLYGACSS---------- 149

  Fly   216 TVPEADVGPVDKKFESVLLGCTLDDQKNIKKRLQALMAYLNKQTVS 261
               |...||||:||:|:::||.::|||.||:||:.|:..::....|
 Frog   150 ---EVPAGPVDQKFQSIIIGCAIEDQKRIKRRLETLIRNIDNSEKS 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7945NP_730051.1 None
bag2NP_001006729.1 BAG 114..193 CDD:383013 31/92 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 101 1.000 Domainoid score I6819
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31233
Inparanoid 1 1.050 102 1.000 Inparanoid score I4841
OMA 1 1.010 - - QHG46876
OrthoDB 1 1.010 - - D1268987at2759
OrthoFinder 1 1.000 - - FOG0006323
OrthoInspector 1 1.000 - - oto103366
Panther 1 1.100 - - LDO PTHR12334
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3579
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.200

Return to query results.
Submit another query.