DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7945 and bag2

DIOPT Version :9

Sequence 1:NP_730051.1 Gene:CG7945 / 39679 FlyBaseID:FBgn0036505 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_957294.2 Gene:bag2 / 393975 ZFINID:ZDB-GENE-040426-1399 Length:208 Species:Danio rerio


Alignment Length:167 Identity:54/167 - (32%)
Similarity:99/167 - (59%) Gaps:15/167 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 SERFVTILDSLDARVEKLRKDALNLQEKKDYLLMSMDLIKSNEMMQNMSEAEREEIILYLQRVSS 152
            |.|.:..||.::.|||.||::|..::::::.|:..:..|::::.|:::.:.||||:.|...|:..
Zfish    28 SGRLLESLDQIEMRVEALREEASAMEQERECLIEMIQSIQNSQEMRSICDGEREELSLTAARLMG 92

  Fly   153 RLATVELRVRTVRDNSQEDSLSQINVLIDSMIK--MGDPVIGRQRCQFYLNACCSSSMDPSGHMD 215
            |..||::.:.|:|:..||::|.:...:||.:.:  :.|....|.|.: .|:|.|.|...|.    
Zfish    93 RTLTVKVSLETIRNQQQEEALQKAMKMIDEITEKVLEDLQSARTRLE-ALHAACVSDAPPV---- 152

  Fly   216 TVPEADVGPVDKKFESVLLGCTLDDQKNIKKRLQALM 252
                    |||:||:||::.|.|:|||.||:||:.|:
Zfish   153 --------PVDQKFQSVVISCALEDQKKIKRRLETLI 181



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594931
Domainoid 1 1.000 93 1.000 Domainoid score I7491
eggNOG 1 0.900 - - E1_KOG3633
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31233
Inparanoid 1 1.050 94 1.000 Inparanoid score I5059
OMA 1 1.010 - - QHG46876
OrthoDB 1 1.010 - - D1268987at2759
OrthoFinder 1 1.000 - - FOG0006323
OrthoInspector 1 1.000 - - oto39368
orthoMCL 1 0.900 - - OOG6_109431
Panther 1 1.100 - - LDO PTHR12334
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3579
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.890

Return to query results.
Submit another query.