DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7945 and Bag2

DIOPT Version :9

Sequence 1:NP_730051.1 Gene:CG7945 / 39679 FlyBaseID:FBgn0036505 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_663367.1 Gene:Bag2 / 213539 MGIID:1891254 Length:210 Species:Mus musculus


Alignment Length:176 Identity:64/176 - (36%)
Similarity:101/176 - (57%) Gaps:17/176 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 SRALDRPFNASERFVTILDSLDARVEKLRKDALNLQEKKDYLLMSMDLIKSNEMMQNMSEAEREE 142
            |...||    |.|.:..||.|:.|||.||..|..::::|:.||..:..|::::.|:.:|:.||||
Mouse    19 SSMADR----SSRLLESLDQLELRVEALRDAATAVEQEKEILLEMIHSIQNSQDMRQISDGEREE 79

  Fly   143 IILYLQRVSSRLATVELRVRTVRDNSQEDSLSQINVLIDSMI-KMGDPVIGRQRCQFYLNACCSS 206
            :.|...|:..|..|||:.|.|:|:..||:||.....:||.:: |..|.:...:.....|.:.|||
Mouse    80 LNLTANRLMGRTLTVEVSVETIRNPQQEESLKHATRIIDEVVSKFLDDLGNAKSHLMSLYSACSS 144

  Fly   207 SMDPSGHMDTVPEADVGPVDKKFESVLLGCTLDDQKNIKKRLQALM 252
            .:.|            ||||:||:|:::||.|:|||.||:||:.|:
Mouse   145 EVPP------------GPVDQKFQSIVIGCALEDQKKIKRRLETLL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7945NP_730051.1 None
Bag2NP_663367.1 BAG 109..189 CDD:214591 29/82 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849341
Domainoid 1 1.000 106 1.000 Domainoid score I6567
eggNOG 1 0.900 - - E1_KOG3633
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31233
Inparanoid 1 1.050 107 1.000 Inparanoid score I4907
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46876
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006323
OrthoInspector 1 1.000 - - oto93109
orthoMCL 1 0.900 - - OOG6_109431
Panther 1 1.100 - - LDO PTHR12334
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3579
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.880

Return to query results.
Submit another query.