DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7945 and unc-23

DIOPT Version :9

Sequence 1:NP_730051.1 Gene:CG7945 / 39679 FlyBaseID:FBgn0036505 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_505307.1 Gene:unc-23 / 179272 WormBaseID:WBGene00006760 Length:458 Species:Caenorhabditis elegans


Alignment Length:214 Identity:63/214 - (29%)
Similarity:103/214 - (48%) Gaps:27/214 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 QDLRADAMASSSP--SGSGGGGNGGNSSYGLVDDSRALDRPFNASERFVTILDSLDARVEKLRKD 108
            |:...|....:||  .|....|.....:..:||        |||  :.:..||.::.:||:|||.
 Worm   252 QETDGDPSPLTSPITEGKPKRGKKLQRNQSVVD--------FNA--KTIVTLDKIELQVEQLRKK 306

  Fly   109 ALNLQEKKDYLLMSMDLIKSNEMMQNMSEAEREEIILYLQRVSSRLATVELRVRTVRDNSQEDSL 173
            |..|:.:|:.:|.|:..|..:..|..:.|.:||||.....|::.|..||::.|.|.|:..|:.:|
 Worm   307 AAELEMEKEQILRSLGEISVHNCMFKLEECDREEIEAITDRLTKRTKTVQVVVETPRNEEQKKAL 371

  Fly   174 SQINVLIDSMIKMGDPVIGRQR-C-QFYLNACCSSSMDPSGHMDTVPEADVGPVDKKFESVLLGC 236
            ....::||.:.:|....|.:.: | |.|:|||..             |...|...:.|..:::.|
 Worm   372 EDATLMIDEVGEMMHSNIEKAKLCLQTYMNACSY-------------EETAGATCQNFLKIIIQC 423

  Fly   237 TLDDQKNIKKRLQALMAYL 255
            ..||||.||:||:.||:.:
 Worm   424 AADDQKRIKRRLENLMSQI 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7945NP_730051.1 None
unc-23NP_505307.1 SMC_prok_B <275..>452 CDD:274008 57/191 (30%)
BAG 370..450 CDD:214591 25/86 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166488
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H31233
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1268987at2759
OrthoFinder 1 1.000 - - FOG0006323
OrthoInspector 1 1.000 - - oto19429
orthoMCL 1 0.900 - - OOG6_109431
Panther 1 1.100 - - LDO PTHR12334
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3579
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.