DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mex1 and ZRG17

DIOPT Version :9

Sequence 1:NP_001189110.1 Gene:mex1 / 39677 FlyBaseID:FBgn0004228 Length:83 Species:Drosophila melanogaster
Sequence 2:NP_014437.1 Gene:ZRG17 / 855775 SGDID:S000005322 Length:605 Species:Saccharomyces cerevisiae


Alignment Length:62 Identity:11/62 - (17%)
Similarity:28/62 - (45%) Gaps:11/62 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LSIVFSALLMVVVIGLIVYFTVFYHKDKNTDEVQKQVAQLT--------PI---VKRSIRDY 78
            :::.:|.|::.:|:..:..:..||....:..:.:..:..:|        |:   :..||.||
Yeast   365 ITLWYSILMINLVLSTLSLYKTFYANKYSNLKTKNPIITITYTAYLFIYPLLLDLLSSISDY 426



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.928771 Normalized mean entropy S12684
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.