powered by:
Protein Alignment mex1 and ZRG17
DIOPT Version :9
Sequence 1: | NP_001189110.1 |
Gene: | mex1 / 39677 |
FlyBaseID: | FBgn0004228 |
Length: | 83 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_014437.1 |
Gene: | ZRG17 / 855775 |
SGDID: | S000005322 |
Length: | 605 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 62 |
Identity: | 11/62 - (17%) |
Similarity: | 28/62 - (45%) |
Gaps: | 11/62 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 LSIVFSALLMVVVIGLIVYFTVFYHKDKNTDEVQKQVAQLT--------PI---VKRSIRDY 78
:::.:|.|::.:|:..:..:..||....:..:.:..:..:| |: :..||.||
Yeast 365 ITLWYSILMINLVLSTLSLYKTFYANKYSNLKTKNPIITITYTAYLFIYPLLLDLLSSISDY 426
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0.928771 |
Normalized mean entropy |
S12684 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.