DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MsrA and MXR1

DIOPT Version :9

Sequence 1:NP_001261879.1 Gene:MsrA / 39675 FlyBaseID:FBgn0000565 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_010960.1 Gene:MXR1 / 856765 SGDID:S000000844 Length:184 Species:Saccharomyces cerevisiae


Alignment Length:169 Identity:58/169 - (34%)
Similarity:81/169 - (47%) Gaps:28/169 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KELNISPVHDVNVTKATATFGMGCFWGAESLYG--ATRGVLRTTVGYAGG---SSDLP---TYRK 81
            |.:...|..|..:|.|     .|||||.|.:|.  ....::...||||.|   ..|.|   :|::
Yeast     7 KTIKYDPAKDKLITLA-----CGCFWGTEHMYRKYLNDRIVDCKVGYANGEESKKDSPSSVSYKR 66

  Fly    82 M----GDHTEVLEIDYDPTVISFKELLDLFWNNHEYGLTT-----PIK-RQYAS-LILYHDEEQK 135
            :    .|..|||::.|:|.||:.:||.|.|:..|:  .||     |.| .||.| |..:.|.:.|
Yeast    67 VCGGDTDFAEVLQVSYNPKVITLRELTDFFFRIHD--PTTSNSQGPDKGTQYRSGLFAHSDADLK 129

  Fly   136 QVAHASKLEEQERRAPEIITTEIASKENFYPAEAYHQKY 174
            ::|...  ||.:.:....|.|.|...:|||.||.|||.|
Yeast   130 ELAKIK--EEWQPKWGNKIATVIEPIKNFYDAEEYHQLY 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MsrANP_001261879.1 PMSR 42..174 CDD:279899 52/150 (35%)
MXR1NP_010960.1 msrA 17..171 CDD:129496 55/159 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345962
Domainoid 1 1.000 67 1.000 Domainoid score I2354
eggNOG 1 0.900 - - E1_COG0225
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I1711
Isobase 1 0.950 - 0 Normalized mean entropy S1937
OMA 1 1.010 - - QHG61104
OrthoFinder 1 1.000 - - FOG0001432
OrthoInspector 1 1.000 - - oto99820
orthoMCL 1 0.900 - - OOG6_100458
Panther 1 1.100 - - O PTHR42799
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R752
SonicParanoid 1 1.000 - - X1438
TreeFam 00.000 Not matched by this tool.
1413.780

Return to query results.
Submit another query.