DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MsrA and PMSR1

DIOPT Version :9

Sequence 1:NP_001261879.1 Gene:MsrA / 39675 FlyBaseID:FBgn0000565 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001331838.1 Gene:PMSR1 / 836286 AraportID:AT5G61640 Length:229 Species:Arabidopsis thaliana


Alignment Length:182 Identity:61/182 - (33%)
Similarity:95/182 - (52%) Gaps:21/182 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LKDLSTVRNEQKELNISPVHDVNVTKATA------TFGMGCFWGAESLYGATRGVLRTTVGYAGG 72
            |..|....:.|..::.||:..|...:|.|      .||.||||..|..|....||.:|.|||:.|
plant    31 LNKLGIGSSRQTNMDPSPIAQVIDDEAPAPGNQFTQFGAGCFWSVELAYQRVPGVTQTEVGYSQG 95

  Fly    73 SSDLPTYRKM----GDHTEVLEIDYDPTVISFKELLDLFWNNHEYGLTTPIKR-------QYASL 126
            .:..|:|:.:    .:|.|::.:.|||...|::.||||||:.|:   .|.:.|       ||.|.
plant    96 ITHDPSYKDVCSGTTNHAEIVRVQYDPKECSYQSLLDLFWSKHD---PTTLNRQGNDVGTQYRSG 157

  Fly   127 ILYHDEEQKQVAHASKLEEQERRAPEIITTEIASKENFYPAEAYHQKYRLQG 178
            |.:::.||:::|..| ||..:::....:.|||...:.||.||.:||:|..:|
plant   158 IYFYNPEQEKLARES-LERHQQQVDRKVVTEILPAKKFYRAEEHHQQYLSKG 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MsrANP_001261879.1 PMSR 42..174 CDD:279899 52/148 (35%)
PMSR1NP_001331838.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0225
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1383773at2759
OrthoFinder 1 1.000 - - FOG0001432
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100458
Panther 1 1.100 - - O PTHR42799
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1438
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.