DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MsrA and PMSR3

DIOPT Version :9

Sequence 1:NP_001261879.1 Gene:MsrA / 39675 FlyBaseID:FBgn0000565 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_196364.1 Gene:PMSR3 / 830638 AraportID:AT5G07470 Length:202 Species:Arabidopsis thaliana


Alignment Length:175 Identity:62/175 - (35%)
Similarity:90/175 - (51%) Gaps:27/175 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QKELNISPVHDVN--VTKAT----ATFGMGCFWGAESLYGATRGVLRTTVGYAGGSSDLPTYRKM 82
            |..::.||:...|  .|.|.    |.||.|||||.|..:....||.:|..||..|:.|.|:|   
plant    14 QTNMDPSPIAQGNDDDTPAPGNQFAQFGAGCFWGVELAFQRVPGVTQTEAGYTQGTVDNPSY--- 75

  Fly    83 GD-------HTEVLEIDYDPTVISFKELLDLFWNNHEYGLTTPIKR-------QYASLILYHDEE 133
            ||       |:||:.:.||....:::.||||||:.|:   .|.:.|       ||.|.|.::..|
plant    76 GDVCSGTTGHSEVVRVQYDLNDCTYESLLDLFWSRHD---PTTLNRQGNDVGTQYRSGIYFYTPE 137

  Fly   134 QKQVAHASKLEEQERRAPEIITTEIASKENFYPAEAYHQKYRLQG 178
            |:::|..| ||..:::....|.|||...:.||.||.:||:|..:|
plant   138 QEKLARES-LERHQQQMERKIMTEILPAKKFYRAEEHHQQYLSKG 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MsrANP_001261879.1 PMSR 42..174 CDD:279899 54/145 (37%)
PMSR3NP_196364.1 PMSR 40..180 CDD:376578 54/146 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0225
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1383773at2759
OrthoFinder 1 1.000 - - FOG0001432
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100458
Panther 1 1.100 - - O PTHR42799
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1438
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.