DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MsrA and PMSR2

DIOPT Version :9

Sequence 1:NP_001261879.1 Gene:MsrA / 39675 FlyBaseID:FBgn0000565 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_196363.1 Gene:PMSR2 / 830637 AraportID:AT5G07460 Length:218 Species:Arabidopsis thaliana


Alignment Length:148 Identity:56/148 - (37%)
Similarity:82/148 - (55%) Gaps:15/148 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ATFGMGCFWGAESLYGATRGVLRTTVGYAGGSSDLPTYRKM----GDHTEVLEIDYDPTVISFKE 102
            |.|..|||||.|..:....||..|.|||..|.|..|:|..:    .:|.||:.:.|||...:::.
plant    54 AEFAAGCFWGVELAFQRIPGVTVTEVGYTHGISHNPSYEDVCTNTTNHAEVVRVQYDPKECTYET 118

  Fly   103 LLDLFWNNHEYGLTTPIKR-------QYASLILYHDEEQKQVAHASKLEEQERRAPEIITTEIAS 160
            ||||||:.|.   .|.:.|       ||.|.|.::..||:::|..| ||:::::..:.|.|||..
plant   119 LLDLFWSRHN---PTTLNRQGELLGAQYRSGIYFYTPEQEKLARES-LEKEQKKLEDKIVTEILP 179

  Fly   161 KENFYPAEAYHQKYRLQG 178
            .:.||.||.|||:|.::|
plant   180 AKKFYKAEEYHQQYLVKG 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MsrANP_001261879.1 PMSR 42..174 CDD:279899 54/142 (38%)
PMSR2NP_196363.1 PMSR 56..196 CDD:396272 54/143 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0225
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1383773at2759
OrthoFinder 1 1.000 - - FOG0001432
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100458
Panther 1 1.100 - - O PTHR42799
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1438
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.