DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MsrA and PMSR4

DIOPT Version :10

Sequence 1:NP_001261879.1 Gene:MsrA / 39675 FlyBaseID:FBgn0000565 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_194243.1 Gene:PMSR4 / 828616 AraportID:AT4G25130 Length:258 Species:Arabidopsis thaliana


Alignment Length:148 Identity:59/148 - (39%)
Similarity:82/148 - (55%) Gaps:15/148 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ATFGMGCFWGAESLYGATRGVLRTTVGYAGGSSDLPTYRKM----GDHTEVLEIDYDPTVISFKE 102
            |.||.|||||.|..|....||.:|.|||:.|....|:|..:    ..|.||:.:.|||...||:.
plant    94 AQFGAGCFWGVELAYQRVPGVTKTEVGYSHGIVHNPSYEDVCTGTTGHNEVVRVQYDPKECSFES 158

  Fly   103 LLDLFWNNHEYGLTTPIKR-------QYASLILYHDEEQKQVAHASKLEEQERRAPEIITTEIAS 160
            |||:|||.|:   .|.:.|       ||.|.|.|:.:||:::|..: :|:|::...:.|.|||..
plant   159 LLDVFWNRHD---PTTLNRQGGDVGTQYRSGIYYYTDEQERIAREA-VEKQQKILNKRIVTEILP 219

  Fly   161 KENFYPAEAYHQKYRLQG 178
            ...||.||.|||:|..:|
plant   220 ATKFYRAENYHQQYLAKG 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MsrANP_001261879.1 PMSR 41..174 CDD:460270 57/142 (40%)
PMSR4NP_194243.1 MsrA 88..236 CDD:439995 58/145 (40%)

Return to query results.
Submit another query.