DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MsrA and PMSR4

DIOPT Version :9

Sequence 1:NP_001261879.1 Gene:MsrA / 39675 FlyBaseID:FBgn0000565 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_194243.1 Gene:PMSR4 / 828616 AraportID:AT4G25130 Length:258 Species:Arabidopsis thaliana


Alignment Length:148 Identity:59/148 - (39%)
Similarity:82/148 - (55%) Gaps:15/148 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ATFGMGCFWGAESLYGATRGVLRTTVGYAGGSSDLPTYRKM----GDHTEVLEIDYDPTVISFKE 102
            |.||.|||||.|..|....||.:|.|||:.|....|:|..:    ..|.||:.:.|||...||:.
plant    94 AQFGAGCFWGVELAYQRVPGVTKTEVGYSHGIVHNPSYEDVCTGTTGHNEVVRVQYDPKECSFES 158

  Fly   103 LLDLFWNNHEYGLTTPIKR-------QYASLILYHDEEQKQVAHASKLEEQERRAPEIITTEIAS 160
            |||:|||.|:   .|.:.|       ||.|.|.|:.:||:::|..: :|:|::...:.|.|||..
plant   159 LLDVFWNRHD---PTTLNRQGGDVGTQYRSGIYYYTDEQERIAREA-VEKQQKILNKRIVTEILP 219

  Fly   161 KENFYPAEAYHQKYRLQG 178
            ...||.||.|||:|..:|
plant   220 ATKFYRAENYHQQYLAKG 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MsrANP_001261879.1 PMSR 42..174 CDD:279899 57/142 (40%)
PMSR4NP_194243.1 PMSR 96..236 CDD:396272 57/143 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0225
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1383773at2759
OrthoFinder 1 1.000 - - FOG0001432
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100458
Panther 1 1.100 - - O PTHR42799
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1438
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.