DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MsrA and MSRA5

DIOPT Version :9

Sequence 1:NP_001261879.1 Gene:MsrA / 39675 FlyBaseID:FBgn0000565 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_179394.1 Gene:MSRA5 / 816315 AraportID:AT2G18030 Length:254 Species:Arabidopsis thaliana


Alignment Length:172 Identity:69/172 - (40%)
Similarity:105/172 - (61%) Gaps:5/172 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 TATFGMGCFWGAESLYGATRGVLRTTVGYAGGSSDLPTYRKMGDHTEVLEIDYDPTVISFKELLD 105
            :|.|.:|.||.:|:.:|...||:||:.|||||:...|.||.:|||.|.::::|||.:|.:::|||
plant    54 SAVFALGSFWRSEAAFGCINGVVRTSAGYAGGTKTNPEYRNLGDHAESVQVEYDPRIIGYRQLLD 118

  Fly   106 LFWNNHE----YGLTTPIKRQYASLILYHDEEQKQVAHASKLEEQERRAPEIITTEIASKENFYP 166
            :||::|:    :|....:..||.|.|..:..|:.::|..||..||......|:||:|.....||.
plant   119 VFWSSHDSRQVFGQGPDVGNQYRSCIFTNSTEELRLASTSKEREQLNTRSSIVTTQIQQLGTFYR 183

  Fly   167 AEAYHQKYRLQGHKDLASSL-NLSPKLLQTSYVATKLNGYLA 207
            ||..|||:.|:.|..|...: |:..:.|:.|.:|||||||.|
plant   184 AEPDHQKFELKQHPFLIQLIGNMVEEELERSALATKLNGYAA 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MsrANP_001261879.1 PMSR 42..174 CDD:279899 54/135 (40%)
MSRA5NP_179394.1 PMSR 55..197 CDD:279899 56/141 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 123 1.000 Domainoid score I1835
eggNOG 1 0.900 - - E1_COG0225
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H42309
Inparanoid 1 1.050 140 1.000 Inparanoid score I1795
OMA 1 1.010 - - QHG61104
OrthoDB 1 1.010 - - D1383773at2759
OrthoFinder 1 1.000 - - FOG0001432
OrthoInspector 1 1.000 - - oto2849
orthoMCL 1 0.900 - - OOG6_100458
Panther 1 1.100 - - O PTHR42799
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.