DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MsrA and si:ch1073-358c10.1

DIOPT Version :9

Sequence 1:NP_001261879.1 Gene:MsrA / 39675 FlyBaseID:FBgn0000565 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_009291413.1 Gene:si:ch1073-358c10.1 / 503993 ZFINID:ZDB-GENE-050309-123 Length:267 Species:Danio rerio


Alignment Length:148 Identity:58/148 - (39%)
Similarity:78/148 - (52%) Gaps:23/148 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FGMGCFWGAESLYGATRGVLRTTVGYAGGSSDLPTYRK----MGDHTEVLEIDYDPTVISFKELL 104
            ||||||||||..:....||..|.||||||.:..|||.:    :..||||:.:.:.|..:|.::||
Zfish    99 FGMGCFWGAERRFWKITGVFSTQVGYAGGFTSNPTYHEVCSGLTGHTEVVRVVFSPKDVSLEKLL 163

  Fly   105 DLFWNNH----------EYGLTTPIKRQYASLILYHDEEQKQVAHASKLEEQE---RRAPEIITT 156
            .:||.:|          ::|      .||.|.|..:..||:.:|..||...||   |:....|||
Zfish   164 KVFWESHDPTQGMAQGNDHG------TQYRSAIYTYSPEQQDLAMKSKHMYQEALSRKGLGEITT 222

  Fly   157 EIASKENFYPAEAYHQKY 174
            :|.....||.||.|||:|
Zfish   223 DIRQLTVFYYAEDYHQQY 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MsrANP_001261879.1 PMSR 42..174 CDD:279899 57/146 (39%)
si:ch1073-358c10.1XP_009291413.1 PRK00058 53..261 CDD:234604 58/148 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594373
Domainoid 1 1.000 98 1.000 Domainoid score I7113
eggNOG 1 0.900 - - E1_COG0225
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I4960
OMA 1 1.010 - - QHG61104
OrthoDB 1 1.010 - - D1383773at2759
OrthoFinder 1 1.000 - - FOG0001432
OrthoInspector 1 1.000 - - otm26124
orthoMCL 1 0.900 - - OOG6_100458
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R752
SonicParanoid 1 1.000 - - X1438
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.740

Return to query results.
Submit another query.