DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MsrA and SelR

DIOPT Version :9

Sequence 1:NP_001261879.1 Gene:MsrA / 39675 FlyBaseID:FBgn0000565 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_731523.1 Gene:SelR / 41309 FlyBaseID:FBgn0267376 Length:208 Species:Drosophila melanogaster


Alignment Length:160 Identity:32/160 - (20%)
Similarity:55/160 - (34%) Gaps:59/160 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 PIKRQYASLILYHDEEQKQVAHASKLEEQERRAP-EIITTEIASKENFYPAEAYHQKYRLQG--- 178
            |.|| |:......|.:.::|. .:|.|.::|..| :...|:.|..|.  |....:.|:..:|   
  Fly    32 PDKR-YSGPAATMDNKSEKVT-VNKEELRKRLTPVQYQVTQEAGTER--PFTGCYNKHYEKGVYQ 92

  Fly   179 ----HKDLASS-------------------------------------LNLSPKLLQTSYVATKL 202
                |:||.||                                     |...|:.::|.....:.
  Fly    93 CIVCHQDLFSSETKYDSGCGWPAFNDVLDKGKVTLHRDASIPGGNILLLIAHPERIRTEVRCARC 157

  Fly   203 NGYLAGVGGIEQFKAEAETMGLTPTQRQYC 232
            |.::..|     |:.     |..||:::||
  Fly   158 NAHMGHV-----FED-----GPKPTRKRYC 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MsrANP_001261879.1 PMSR 42..174 CDD:279899 14/56 (25%)
SelRNP_731523.1 PRK00222 48..186 CDD:234692 27/143 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468238
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.