DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MsrA and Msra

DIOPT Version :9

Sequence 1:NP_001261879.1 Gene:MsrA / 39675 FlyBaseID:FBgn0000565 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_445759.1 Gene:Msra / 29447 RGDID:70979 Length:233 Species:Rattus norvegicus


Alignment Length:182 Identity:67/182 - (36%)
Similarity:90/182 - (49%) Gaps:37/182 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ATFGMGCFWGAESLYGATRGVLRTTVGYAGGSSDLPTYR-----KMGDHTEVLEIDYDPTVISFK 101
            |.||||||||||..:...:||..|.||:|||.:..|||:     |.| |.||:.:.|.|..:||:
  Rat    66 AVFGMGCFWGAERKFWLLKGVYSTQVGFAGGYTRNPTYKEVCSEKTG-HAEVVRVVYRPEHVSFE 129

  Fly   102 ELLDLFWNNHE--YGLT--TPIKRQYASLILYHDEEQKQVAHASKLEEQE---RRAPEIITTEIA 159
            |||.:||.||:  .|:.  .....||.|.:......|.:.|..||.|.|:   :.....|||:|.
  Rat   130 ELLKVFWENHDPTQGMRQGNDCGTQYRSAVYPTSAVQMEAALKSKEEYQKVLSKHGFGPITTDIR 194

  Fly   160 SKENFYPAEAYHQKYRLQGHKDLASSLNLSPKLLQTSYVATKLNGYLAGVGG 211
            ..:.||.||.|||:|           |:.:|            :|| .|:||
  Rat   195 EGQVFYYAEDYHQQY-----------LSKNP------------DGY-CGLGG 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MsrANP_001261879.1 PMSR 42..174 CDD:279899 59/143 (41%)
MsraNP_445759.1 PRK00058 20..228 CDD:234604 67/182 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352444
Domainoid 1 1.000 96 1.000 Domainoid score I7164
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I4949
OMA 1 1.010 - - QHG61104
OrthoDB 1 1.010 - - D1383773at2759
OrthoFinder 1 1.000 - - FOG0001432
OrthoInspector 1 1.000 - - oto97551
orthoMCL 1 0.900 - - OOG6_100458
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1438
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.810

Return to query results.
Submit another query.