powered by:
Protein Alignment MsrA and Msrb1
DIOPT Version :9
Sequence 1: | NP_001261879.1 |
Gene: | MsrA / 39675 |
FlyBaseID: | FBgn0000565 |
Length: | 261 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001333597.1 |
Gene: | Msrb1 / 27361 |
MGIID: | 1351642 |
Length: | 116 |
Species: | Mus musculus |
Alignment Length: | 33 |
Identity: | 9/33 - (27%) |
Similarity: | 19/33 - (57%) |
Gaps: | 1/33 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 87 EVLEIDYDPTV-ISFKELLDLFWNNHEYGLTTP 118
||.:..::|.| :..|...:||.::.:|..::|
Mouse 10 EVFQNHFEPGVYVCAKCSYELFSSHSKYAHSSP 42
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
MsrA | NP_001261879.1 |
PMSR |
42..174 |
CDD:279899 |
9/33 (27%) |
Msrb1 | NP_001333597.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167848840 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.