DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MsrA and SPAC29E6.05c

DIOPT Version :9

Sequence 1:NP_001261879.1 Gene:MsrA / 39675 FlyBaseID:FBgn0000565 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_594563.1 Gene:SPAC29E6.05c / 2542181 PomBaseID:SPAC29E6.05c Length:170 Species:Schizosaccharomyces pombe


Alignment Length:148 Identity:47/148 - (31%)
Similarity:75/148 - (50%) Gaps:17/148 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ATFGMGCFWGAESLY----GATRGVLRTTVGYAGGSSDLPTYRKM----GDHTEVLEIDYDPTVI 98
            |....|||||.:.:|    .....:|:|:|||.||.:..|||:::    .:|.|.|:|::|..:.
pombe     4 AIIAAGCFWGVQEVYLRKFIPAAAILKTSVGYTGGITADPTYKEVCTNTTNHAEALKIEFDEKLT 68

  Fly    99 SFKELLDLFWNNHEYGLTT------PIKRQYASLILYHDEEQKQVAHASKLEEQERRAP-EIITT 156
            |:.::::.|:..|:  .||      .|..||.|.|...:.||..:|.....|.|.:..| :.|.|
pombe    69 SYDKIIEFFFAMHD--PTTSNQQGNDIGTQYRSAIFTTNPEQATIAKRVMNEVQAKHYPNKKIVT 131

  Fly   157 EIASKENFYPAEAYHQKY 174
            :|.....::.||.|||.|
pombe   132 QILPAGKWWDAEDYHQLY 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MsrANP_001261879.1 PMSR 42..174 CDD:279899 46/146 (32%)
SPAC29E6.05cNP_594563.1 MsrA 1..165 CDD:223303 47/148 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 72 1.000 Domainoid score I2591
eggNOG 1 0.900 - - E1_COG0225
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I1912
OMA 1 1.010 - - QHG61104
OrthoFinder 1 1.000 - - FOG0001432
OrthoInspector 1 1.000 - - oto101497
orthoMCL 1 0.900 - - OOG6_100458
Panther 1 1.100 - - O PTHR42799
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R752
SonicParanoid 1 1.000 - - X1438
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.