DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MsrA and msra-1

DIOPT Version :9

Sequence 1:NP_001261879.1 Gene:MsrA / 39675 FlyBaseID:FBgn0000565 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_495540.1 Gene:msra-1 / 185709 WormBaseID:WBGene00018393 Length:207 Species:Caenorhabditis elegans


Alignment Length:186 Identity:74/186 - (39%)
Similarity:102/186 - (54%) Gaps:11/186 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ATFGMGCFWGAESLYGATRGVLRTTVGYAGGSSDLPTYRKMGDHTEVLEIDYDPTVISFKELLDL 106
            |.||:.|||| ||.:...:||:.|.||||||....|||:.:.||||:.||.:||.||.:.:|.:.
 Worm     7 AYFGLQCFWG-ESAWAKLKGVVVTRVGYAGGKQPNPTYKNIKDHTEITEITFDPKVIEYSKLTNF 70

  Fly   107 FWNNHEYGLTTPI---KRQYASLILYHDEEQKQVAHASKLEEQERRAPEIITTEIASKENFYPAE 168
            ||.:|     .|.   |:||.|.|||.:::||:||..:....:::...  |.|.|...:.||.||
 Worm    71 FWKHH-----NPAERRKKQYQSAILYVNDDQKKVAEETLKVAKDKHGD--IETYIEPLDKFYQAE 128

  Fly   169 AYHQKYRLQGHKDLASSLNLSPKLLQTSYVATKLNGYLAGVGGIEQFKAEAETMGL 224
            .|||||..:..|.|...|:|....:....:|||||.|.||.......:..|:..||
 Worm   129 DYHQKYWFRQKKILFDELSLLDTQVAEGELATKLNAYCAGFQDFHDLERLAKEYGL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MsrANP_001261879.1 PMSR 42..174 CDD:279899 57/134 (43%)
msra-1NP_495540.1 PMSR 6..134 CDD:376578 57/134 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158767
Domainoid 1 1.000 111 1.000 Domainoid score I3922
eggNOG 1 0.900 - - E1_COG0225
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H42309
Inparanoid 1 1.050 128 1.000 Inparanoid score I3247
Isobase 1 0.950 - 0 Normalized mean entropy S1937
OMA 1 1.010 - - QHG61104
OrthoDB 1 1.010 - - D1383773at2759
OrthoFinder 1 1.000 - - FOG0001432
OrthoInspector 1 1.000 - - oto18282
orthoMCL 1 0.900 - - OOG6_100458
Panther 1 1.100 - - LDO PTHR42799
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R752
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.