DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MsrA and msra.1

DIOPT Version :9

Sequence 1:NP_001261879.1 Gene:MsrA / 39675 FlyBaseID:FBgn0000565 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_031758940.1 Gene:msra.1 / 100145423 XenbaseID:XB-GENE-1011250 Length:243 Species:Xenopus tropicalis


Alignment Length:204 Identity:58/204 - (28%)
Similarity:93/204 - (45%) Gaps:40/204 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SVTHPELKDLST----------VRNEQKELNISPVHDVNVTKAT---------ATFGMGCFWGAE 53
            |.|:..:.|:|:          :....:::.:|..|.|:.....         |.||||||||||
 Frog    19 SNTYLHMGDMSSKTQLPSKEGALPGRSEKMRVSAKHHVSGNSMVEPFPEGTQMAIFGMGCFWGAE 83

  Fly    54 SLYGATRGVLRTTVGYAGGSSDLPTYRKM----GDHTEVLEIDYDPTVISFKELLDLFWNNHE-- 112
            ..:...:||..|.|||:||.:..|.|.::    ..|.||:.:.|:|..|||::||.:||.||:  
 Frog    84 RKFWRQKGVFSTQVGYSGGYTTNPLYEEVCSGRTGHAEVVRVVYEPGTISFEKLLKVFWENHDPT 148

  Fly   113 YGLT--TPIKRQYASLILYHDEEQKQVAHASKLEEQERR--------APEIITTEIASKE----- 162
            .|:.  ..:...|.|.|..:..||.:.|..|:.:.|:.|        .|.|:...::..:     
 Frog   149 QGMRQGNDVGTMYRSAIYTYTMEQAEAALKSREDFQKVRLYCRTHMAEPAILNDIVSGSQAALSL 213

  Fly   163 NFYPAEAYH 171
            |...:|.||
 Frog   214 NKISSEFYH 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MsrANP_001261879.1 PMSR 42..174 CDD:279899 51/151 (34%)
msra.1XP_031758940.1 PMSR 25..>185 CDD:412337 48/159 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 90 1.000 Domainoid score I7663
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I4953
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1383773at2759
OrthoFinder 1 1.000 - - FOG0001432
OrthoInspector 1 1.000 - - otm48802
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1438
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.