DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MsrA and msra.2

DIOPT Version :9

Sequence 1:NP_001261879.1 Gene:MsrA / 39675 FlyBaseID:FBgn0000565 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_012811860.1 Gene:msra.2 / 100135729 XenbaseID:XB-GENE-921356 Length:217 Species:Xenopus tropicalis


Alignment Length:135 Identity:53/135 - (39%)
Similarity:72/135 - (53%) Gaps:21/135 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LNISPVHDVNVTKA---------TATFGMGCFWGAESLYGATRGVLRTTVGYAGGSSDLPTYRK- 81
            |.::..|.||....         .|.||||||||||.|:....||..|.||:|||.:..|||:: 
 Frog    21 LQVADKHMVNGNSTLEPFPDGLEIAVFGMGCFWGAERLFWKQEGVYSTQVGFAGGHTPNPTYKEV 85

  Fly    82 ---MGDHTEVLEIDYDPTVISFKELLDLFWNNHEYGLTTPIKR------QYASLILYHDEEQKQV 137
               :..|.||:.:.:||.||::|.||.|||.||:  .|..:|:      ||.|:|..:.|.||..
 Frog    86 RTGLTAHAEVVRVVFDPKVITYKVLLKLFWENHD--PTEGMKQGEDVGTQYRSVIFTYGENQKDA 148

  Fly   138 AHASK 142
            |..|:
 Frog   149 ALLSR 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MsrANP_001261879.1 PMSR 42..174 CDD:279899 49/111 (44%)
msra.2XP_012811860.1 PMSR 8..>158 CDD:294260 53/135 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 90 1.000 Domainoid score I7663
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I4953
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1383773at2759
OrthoFinder 1 1.000 - - FOG0001432
OrthoInspector 1 1.000 - - otm48802
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R752
SonicParanoid 1 1.000 - - X1438
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.