DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and OTU1

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_116610.1 Gene:OTU1 / 850500 SGDID:S000001850 Length:301 Species:Saccharomyces cerevisiae


Alignment Length:159 Identity:41/159 - (25%)
Similarity:69/159 - (43%) Gaps:23/159 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 QPTPK--LIELQQITAKLSQRQLSLHNIPSDGDCLYQSIRHQLIVNALPGHSVQELREETANYVR 214
            ||.||  |...:.......:..||:|.:..|..||:.:|.:.:...    .||::|||..:..| 
Yeast    87 QPKPKRVLKSTEMSIGGSGENVLSVHPVLDDNSCLFHAIAYGIFKQ----DSVRDLREMVSKEV- 146

  Fly   215 AHKDSLISYMIHP-ETGDILNDQQFEQYCHDIAKTHAWGGHIELKAISSLLRVPIEVIQAEGAPT 278
                     :.:| :..|.:.|:..:.|...|.|..:|||.||:..||..|.|.|.|:..:....
Yeast   147 ---------LNNPVKFNDAILDKPNKDYAQWILKMESWGGAIEIGIISDALAVAIYVVDIDAVKI 202

  Fly   279 LLGQEEFGGSPLIICYHRHIYQLGAHYNS 307
            ....|:...:.::|.::      |.||:|
Yeast   203 EKFNEDKFDNYILILFN------GIHYDS 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 40/157 (25%)
OTU 178..305 CDD:280496 30/127 (24%)
OTU1NP_116610.1 COG5539 1..300 CDD:227826 41/159 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.