DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and AT1G50670

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001321194.1 Gene:AT1G50670 / 841489 AraportID:AT1G50670 Length:208 Species:Arabidopsis thaliana


Alignment Length:136 Identity:34/136 - (25%)
Similarity:55/136 - (40%) Gaps:27/136 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 IPSDGDCLYQSIRHQLIVNALPGHSVQELREETANYVRAHKDSLISYMIHPETGDILNDQQFEQY 241
            ||||..||:.:|.:   |.....:...|||:..|..|.::|:......:..     ||    |:|
plant    10 IPSDNSCLFNAIGY---VMDKDKNKAPELRQVIAAAVASNKEKYNEAFLGK-----LN----EEY 62

  Fly   242 CHDIAKTHAWGGHIELKAIS-----SLLRVPIEVIQAEGAPTLLGQEEFGGSPLIICYHRHIYQL 301
            |..|.....|||.|||..::     .:....|:..:.:    |.||.......:::.|.      
plant    63 CAWILNPDKWGGAIELSILADYYGREIAAYDIQTSRCD----LYGQTRNYDERVMLIYD------ 117

  Fly   302 GAHYNS 307
            |.||::
plant   118 GLHYDA 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 34/134 (25%)
OTU 178..305 CDD:280496 31/131 (24%)
AT1G50670NP_001321194.1 COG5539 <13..207 CDD:227826 31/133 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.