DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and AT5G03330

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_195953.1 Gene:AT5G03330 / 831875 AraportID:AT5G03330 Length:356 Species:Arabidopsis thaliana


Alignment Length:217 Identity:43/217 - (19%)
Similarity:83/217 - (38%) Gaps:52/217 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 ETEVTDDDG-IEEKEEQLAPNQRVSKAQKRRDKKAKEARAREAEIKTELQNAANQPTPKLIELQQ 162
            |::..|.|| ...:..|:.|...:.|.              ..||..|.:..::.        ::
plant   161 ESDQCDADGEFGRRLNQMVPIPYIPKI--------------NGEIPPEEEAVSDH--------ER 203

  Fly   163 ITAKLSQRQLSLHNIPSDGDCLYQSIRHQLIVNALPGHSVQELREETANYVRAHKDSLISYMIHP 227
            :..:|.....:...:|.||:|.::::..||...| ..|  :.:|.:....:::..||...|:   
plant   204 LRNRLEMFDFTEVKVPGDGNCQFRALADQLYKTA-DRH--KHVRRQIVKQLKSRPDSYQGYV--- 262

  Fly   228 ETGDILNDQQFEQYCHDIAKTHAWGGHIELKAISSLLRVPIEVIQA-------EGAPTLLGQEEF 285
                   ...|..|...::::..||.|:.|:|.:...||.|.|:.:       |..||  .||..
plant   263 -------PMDFSDYLRKMSRSGEWGDHVTLQAAADAYRVKIVVLTSFKDTCYIEILPT--SQESK 318

  Fly   286 GGSPLIICYHRHIYQLGAHYNS 307
            |  .:.:.:...:     |||:
plant   319 G--VIFLSFWAEV-----HYNA 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 42/215 (20%)
OTU 178..305 CDD:280496 29/133 (22%)
AT5G03330NP_195953.1 OTU 219..319 CDD:388712 28/114 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.