DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and AT5G04250

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001119168.1 Gene:AT5G04250 / 830304 AraportID:AT5G04250 Length:345 Species:Arabidopsis thaliana


Alignment Length:335 Identity:66/335 - (19%)
Similarity:120/335 - (35%) Gaps:92/335 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DGDVAIAELESRLDEVSLEDIGARHRRERKDLQAKLQAMKKNAP--------------KNNKNKR 53
            |.|..||:...  ||:|            :..:|:...:...:|              :.|:.:.
plant    58 DNDAVIAQFYQ--DELS------------RVARAEASGINSLSPTSVVAQDWPHPHQGQENQGEA 108

  Fly    54 KEFLEEMARL---EGELEQRHKAELKAAEAMEAPVLVEPVVKEPAEKPETEVTDDD---GIEEKE 112
            .:..:|...|   .|.:|.::.|.::......:|                 ..|||   .:|.:|
plant   109 IDITQESDILHNHNGNMEDKNVARIRFEGGQSSP-----------------SRDDDSVCSVEIEE 156

  Fly   113 EQLAPNQRVSKAQKRRDKKAKEARAREAEIKTELQNAANQPTPKLIELQQITAKLSQRQLSLHNI 177
            |..      |:..||.::....|..  .:|..||.:...|    :.:.:::..:|....|..:.|
plant   157 ESW------SEVGKRLNQMIPIAHV--PKINGELPSEDEQ----ISDHERLFQRLQLYGLVENKI 209

  Fly   178 PSDGDCLYQSIRHQLIVNALPGHSVQELREETANYVRAHKDSLISYMIHPETGDILNDQQFEQYC 242
            ..||:|.::|:..||..:  |.|. ..:||:..|.:..:::....|:          ...:..|.
plant   210 EGDGNCQFRSLSDQLYRS--PEHH-NFVREQVVNQLAYNREIYEGYV----------PMAYNDYL 261

  Fly   243 HDIAKTHAWGGHIELKAISSLLRVPIEVIQA-------EGAPTLLGQEEFGGSPLIICYHRHIYQ 300
            ..:.:...||.|:.|:|.:.|..|.:.||.:       |..|      .|..|..:||..   :.
plant   262 KAMKRNGEWGDHVTLQAAADLFGVRMFVITSFKDTCYIEILP------HFQKSNRLICLS---FW 317

  Fly   301 LGAHYNSTVP 310
            ...||||..|
plant   318 AEVHYNSIYP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 58/316 (18%)
OTU 178..305 CDD:280496 28/133 (21%)
AT5G04250NP_001119168.1 OTU 211..>295 CDD:418725 22/96 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.