DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and AT3G22260

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001189948.1 Gene:AT3G22260 / 821796 AraportID:AT3G22260 Length:245 Species:Arabidopsis thaliana


Alignment Length:183 Identity:35/183 - (19%)
Similarity:71/183 - (38%) Gaps:52/183 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 TDDDGIEEKEEQLAPNQRVSKAQKRRDKKAKEARAREAEIKTELQNAANQP-TPKL--------- 157
            ||||            |.::     |.....|:..||.::...|.:..:.| ||::         
plant    37 TDDD------------QTIA-----RILAEDESLRREGKLGKRLSHLDSIPHTPRVNREIPDIND 84

  Fly   158 --IELQQITAKLSQRQLSLHNIPSDGDCLYQSIRHQLIVNA-----LPGHSVQELREETANYVRA 215
              ::.:.::.:|:...|:...:..||:|.::::..||..||     :..|.|::|:::...|.  
plant    85 ATLDHELLSGRLATYGLAELQMEGDGNCQFRALADQLFRNADYHKHVRKHVVKQLKQQRKLYE-- 147

  Fly   216 HKDSLISYMIHPETGDILNDQQFEQYCHDIAKTHAWGGHIELKAISSLLRVPI 268
                  .|:          ..::..|...:.|...||.|:.|:|.:......|
plant   148 ------EYV----------PMKYRHYTRKMKKHGEWGDHVTLQAAADRFEAKI 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 35/183 (19%)
OTU 178..305 CDD:280496 20/96 (21%)
AT3G22260NP_001189948.1 OTU 108..>192 CDD:418725 20/95 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.