DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and OTLD1

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001189616.1 Gene:OTLD1 / 817278 AraportID:AT2G27350 Length:506 Species:Arabidopsis thaliana


Alignment Length:324 Identity:53/324 - (16%)
Similarity:116/324 - (35%) Gaps:56/324 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LESRLDEVSLEDIGARHRRERKDLQAKLQAMKKNAPKNNKNKRKEFLEEMARLEGELEQRHKAEL 75
            ::..:.:...|::....:.|..|  ||..|:..:.|.:.::.....:.|...::.|         
plant    45 IDEEITDEKQEEVTVVEKAECSD--AKDVAVDSDEPADREDDEGLVVAENVHVQSE--------- 98

  Fly    76 KAAEAMEAPV-----LVEPVVKEPAEKPETEVTDDDGIEEKEE----QLAPNQRV----SKAQKR 127
              ....::||     ...|.|..|..||.:.|...........    ::.|.:|.    |....|
plant    99 --GIDCDSPVSGGSNSDSPPVPAPPPKPSSTVNPGSNRSVLGSFGALRIGPTRRAAGPRSLVSSR 161

  Fly   128 RDKKAKEARAREAEIKTELQNAANQ---------PTPKLIELQQITAKLS-QRQLSLHNIPSDGD 182
            .........:..:..:.|..|::::         |...|....|..|::. .:...:..:..||:
plant   162 SSPTGSHPSSPRSHSENEGYNSSDEHMPCYVPSHPGSGLEREHQFEAEIRYSKGFEIRRMLEDGN 226

  Fly   183 CLYQSIRHQLIVNALPGHSVQELREETANYVRAHKDSLISYMIHPETGDILNDQQFEQYCHDIAK 247
            ||::::..|:..::   .:....|:...:|:...:|....::          .:.|..|.....:
plant   227 CLFRAVADQVYGDS---EAYDLARQMCMDYMEQERDHFSQFI----------TEGFTSYLKRKRR 278

  Fly   248 THAWGGHIELKAISSLLRVPIEVIQAEGAPTLLGQEEFGGS--PLIICYHRHIYQLGAHYNSTV 309
            ...:|.::|::|::.:...||.:......|..:.|..:...  |:.:.||.     |.||||.|
plant   279 DKVYGNNVEIQALAEMYNRPIHIYSYSTEPINIFQGNYSTDTPPIRLSYHH-----GNHYNSLV 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 50/314 (16%)
OTU 178..305 CDD:280496 21/128 (16%)
OTLD1NP_001189616.1 OTU 224..333 CDD:303090 21/126 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.