DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and itprid2

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001072601.3 Gene:itprid2 / 780056 XenbaseID:XB-GENE-981013 Length:1225 Species:Xenopus tropicalis


Alignment Length:223 Identity:54/223 - (24%)
Similarity:78/223 - (34%) Gaps:68/223 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LQAKLQAM-KKNAPKNNKNKRKEFLEEMARLEG---ELEQRHKAELKAAEAMEAPVLVEPVVKEP 94
            :..|||.: |||:|.      ...:.|.|...|   :|.....|...|....||  |.||..::|
 Frog   324 IDQKLQKLFKKNSPP------LATVSEEASNSGIVLDLNPIDPASFSADNLDEA--LAEPCTEKP 380

  Fly    95 -------------------AEKPETEVTDDDG----IEE-------KEEQLAPNQRVSK--AQKR 127
                               |.|....:||.:.    .||       ::|..|||:.:..  :|.:
 Frog   381 EDSSVSQNECDISGIADSSAAKNTDVITDQESESYITEENPNTSTPEKELYAPNKAIMNLISQPK 445

  Fly   128 RDKKAKEARAREAEIKTELQNAANQPTPKLIELQQITAKLSQ----RQLSLHNIPS------DGD 182
            ...:.:|.:..|.|      ...|.||...||      ||.:    |..|.|:..|      ..|
 Frog   446 DSFELEELQGSEDE------PPLNPPTCHAIE------KLGKDNLLRTASQHSDSSGFAEDTSAD 498

  Fly   183 CLYQSI-RHQLIVNALPGHSVQELREET 209
            ||..|: :.|..:.|: |.|......||
 Frog   499 CLLASLAQGQESLQAM-GSSADSCDSET 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 54/223 (24%)
OTU 178..305 CDD:280496 11/39 (28%)
itprid2NP_001072601.3 KRAP_IP3R_bind 136..282 CDD:405421
SSFA2_C 835..1011 CDD:405422
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165164699
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.