DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and otud4

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001072598.1 Gene:otud4 / 780053 XenbaseID:XB-GENE-5900161 Length:1051 Species:Xenopus tropicalis


Alignment Length:137 Identity:30/137 - (21%)
Similarity:55/137 - (40%) Gaps:24/137 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 IPSDGDCLYQSIRHQLIVNALPGHSVQE---LREETANYVRAHKDSLISYMIHPETGDILNDQQF 238
            |..||.||::::..|::      ||..|   :|:...||:|.::...          :.|.:..|
 Frog    33 IAKDGSCLFRAVAEQVM------HSQSEHLKIRKSCINYLRKNRGQY----------EALIEGSF 81

  Fly   239 EQYCHDIAKTHAWGGHIELKAISSLLRVPIEVIQAEGAPTLLGQEEFGGSPLIICYHRHIYQLGA 303
            |.|...:.....|.|.:|:.|:|.:.:....:.|....|.....|......:::|:..     |.
 Frog    82 EDYLKSLENPQEWVGQVEISALSLMFKKDFIIYQEPNVPPACVTENGFSEKIMLCFSN-----GN 141

  Fly   304 HYNSTVP 310
            ||:...|
 Frog   142 HYDIIYP 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 29/132 (22%)
OTU 178..305 CDD:280496 26/129 (20%)
otud4NP_001072598.1 OTU 36..>115 CDD:303090 21/94 (22%)
TUDOR 282..330 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.