DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and Otud4

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001242962.1 Gene:Otud4 / 73945 MGIID:1098801 Length:1107 Species:Mus musculus


Alignment Length:147 Identity:31/147 - (21%)
Similarity:65/147 - (44%) Gaps:28/147 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 RQLSLHN--IPSDGDCLYQSIRHQLIVNALPGHSVQ---ELREETANYVRAHKDSLISYMIHPET 229
            |:|.|:.  :..||.||::::..|::      ||..   |:|.....|:|.:::...:::     
Mouse    30 RKLGLYRKLVAKDGSCLFRAVAEQVL------HSQSRHVEVRMACIRYLRENREKFEAFI----- 83

  Fly   230 GDILNDQQFEQYCHDIAKTHAWGGHIELKAISSLLRVPIEVIQAEG-APTLLGQEEFGGSPLIIC 293
                 :..||:|...:.....|.|.:|:.|:|.:.|....:.|... :|:.:.:..| ...:::|
Mouse    84 -----EGSFEEYLKRLENPQEWVGQVEISALSLMYRKDFVIYQEPNVSPSHVTENNF-PEKVLLC 142

  Fly   294 YHRHIYQLGAHYNSTVP 310
            :..     |.||:...|
Mouse   143 FSN-----GNHYDIVYP 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 30/142 (21%)
OTU 178..305 CDD:280496 25/130 (19%)
Otud4NP_001242962.1 Cys-loop. /evidence=ECO:0000250|UniProtKB:Q5VVQ6 39..45 2/5 (40%)
OTU 42..>121 CDD:303090 20/94 (21%)
Variable-loop. /evidence=ECO:0000250|UniProtKB:Q5VVQ6 94..104 2/9 (22%)
His-loop. /evidence=ECO:0000250|UniProtKB:Q5VVQ6 143..148 1/9 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..239
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 322..431
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 470..568
T4BSS_DotH_IcmK 558..>644 CDD:289093
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 918..1107
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835254
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.