Sequence 1: | NP_648769.2 | Gene: | CG7857 / 39671 | FlyBaseID: | FBgn0026738 | Length: | 312 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001364018.1 | Gene: | Otud3 / 73162 | MGIID: | 1920412 | Length: | 443 | Species: | Mus musculus |
Alignment Length: | 211 | Identity: | 56/211 - (26%) |
---|---|---|---|
Similarity: | 92/211 - (43%) | Gaps: | 49/211 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 120 RVSKAQKRRDKK-AKEARAREAEIKTELQNAANQPTPK----LIELQQITAKLSQRQLSLHNIPS 179
Fly 180 DGDCLYQSIRHQLIVNALPGHSVQEL--REETANY-VRAHKDSLISYMIHPETGDILNDQQFEQY 241
Fly 242 CHDIAKTHAWGGHIELKAISSLLRVPIEVIQAEGAP--TLLGQEEFGGSPLIICYHRHI-YQLGA 303
Fly 304 HY--------NSTVPA 311 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7857 | NP_648769.2 | COG5539 | 17..307 | CDD:227826 | 52/205 (25%) |
OTU | 178..305 | CDD:280496 | 35/132 (27%) | ||
Otud3 | NP_001364018.1 | OTU | 70..182 | CDD:388712 | 35/132 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |