DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and Otud6b

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_036020347.1 Gene:Otud6b / 72201 MGIID:1919451 Length:298 Species:Mus musculus


Alignment Length:305 Identity:112/305 - (36%)
Similarity:172/305 - (56%) Gaps:55/305 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DVAIAELESRLDEVSLEDIGARHRRERKDLQAKLQAMKKNAPKNNKNKRKEFLEEMARLEGELEQ 69
            :|...||:   ||   |.:..|||:|:|:||||:|.||...|||:|.:||:..|::|:||.|:||
Mouse    34 EVVAEELD---DE---EQLVRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEREMEQ 92

  Fly    70 RHKAELKAAEAMEAPVLVEPVVKEPAEKPETEVTDDDGIEEKEEQLAPNQRVSKAQKRRDKKAKE 134
            :|:.||:..:                     ::|..|               ||.:|...:|.:|
Mouse    93 KHREELEQLK---------------------QLTFKD---------------SKEKKAALEKERE 121

  Fly   135 ARAREAEIKTELQNAANQPTPKLIELQQITAKLSQRQLSLHNIPSDGDCLYQSIRHQLIVN--AL 197
            .|..||||: .|..|.:..:.||.::      |:.|:|.:..|||||.|:|.::..||...  ||
Mouse   122 ERIAEAEIE-NLSGARHLESEKLAQI------LAARELEIKQIPSDGHCMYGALEDQLREQDCAL 179

  Fly   198 PGHSVQELREETANYVRAHKDSLISYMIHPETGDILNDQQFEQYCHDIAKTHAWGGHIELKAISS 262
               :|..||.:||.|::.|.|..:.::.:|.|||:...::|.:||.||..|.||||.:||:|:|.
Mouse   180 ---TVASLRRQTAEYMQTHSDDFLPFLTNPSTGDMYTPEEFGKYCDDIVNTAAWGGQLELRALSH 241

  Fly   263 LLRVPIEVIQAEGAPTLLGQEEFGGSPLIICYHRHIYQLGAHYNS 307
            :|:.|||::||:..|.::| ||:..:||::.|.||.|.||.||||
Mouse   242 ILQTPIEILQADAPPIIVG-EEYPRNPLVLVYMRHAYGLGEHYNS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 106/291 (36%)
OTU 178..305 CDD:280496 54/128 (42%)
Otud6bXP_036020347.1 OTU 158..283 CDD:396767 54/128 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 120 1.000 Domainoid score I5740
eggNOG 1 0.900 - - E1_COG5539
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6064
Inparanoid 1 1.050 204 1.000 Inparanoid score I3734
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003029
OrthoInspector 1 1.000 - - otm44052
orthoMCL 1 0.900 - - OOG6_102788
Panther 1 1.100 - - LDO PTHR12419
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3778
SonicParanoid 1 1.000 - - X2018
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.860

Return to query results.
Submit another query.