DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and Otud1

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_081991.1 Gene:Otud1 / 71198 MGIID:1918448 Length:454 Species:Mus musculus


Alignment Length:248 Identity:64/248 - (25%)
Similarity:106/248 - (42%) Gaps:54/248 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 HKAELKAAEAMEAPVLVEPVVKEPAEKPETEVTDDDGIEEKEEQLA---------PNQRVSKAQK 126
            |:..| ||....||. ..||..||...|.   :...|.|.:.|:.:         .:...|.|.:
Mouse   162 HRQAL-AASQHRAPA-PAPVGPEPGAGPG---SGPWGEERRAERSSRGWDRASGRSDASGSDALR 221

  Fly   127 RRDKKAKEARAREAEIKTELQNAAN---------QPTPK-------LIELQQITAKLSQR-QLSL 174
            |:|.:| ||....|..::..:.|.|         :..|:       |.|:::....|.|| :...
Mouse   222 RQDPEA-EAHPVPAPARSSGEPAQNGEGEAVGTSRADPRDEKLALYLAEVERQDKYLRQRNKYRF 285

  Fly   175 HNIPSDGDCLYQSIRHQLIVNALPGHSVQELREETANYVRAHKDSLISYMIHPETGDILNDQQFE 239
            |.|| ||:|||::: .:.:......|  :||||:|.:|:..|.|. .|.:|..:.|         
Mouse   286 HIIP-DGNCLYRAV-SKTVYGDQSLH--RELREQTVHYIADHLDH-FSPLIEGDVG--------- 336

  Fly   240 QYCHDIAKTHAWGGHIELKAISSLLRVPIEV-----IQAEGAPTL---LGQEE 284
            ::....|:..||.|:.||.|:..:|.|.|.:     :::....|:   ||.|:
Mouse   337 EFIIAAAQDGAWAGYPELLAMGQMLNVNIHLTTGGRLESPTVSTMIHYLGPED 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 64/248 (26%)
OTU 178..305 CDD:280496 32/115 (28%)
Otud1NP_081991.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..64
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..257 24/100 (24%)
Cys-loop. /evidence=ECO:0000250 287..293 4/6 (67%)
OTU 288..405 CDD:280496 33/116 (28%)
His-loop. /evidence=ECO:0000250 342..352 4/9 (44%)
Variable-loop. /evidence=ECO:0000250 399..404
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.