DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and alg13

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_005161471.1 Gene:alg13 / 557181 ZFINID:ZDB-GENE-060307-1 Length:889 Species:Danio rerio


Alignment Length:131 Identity:28/131 - (21%)
Similarity:56/131 - (42%) Gaps:18/131 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 DGDCLYQSIRHQLIVNALPGHSVQELREETANYVRAHKDSLISYMIHPETGDILNDQQFEQYCHD 244
            |..||::::..||..:.   :..|.:|:|..|::||::.:...::          :..||:|...
Zfish    29 DASCLFRAVSEQLYYSQ---NYHQRIRKECVNFIRANRCNFEPFV----------EGSFEKYLER 80

  Fly   245 IAKTHAWGGHIELKAISSLLRVPIEVIQAEGAPTLLGQEEFGGSPLIICYHRHIYQLGAHYNSTV 309
            :.......|.:.:||:|.|.|....:.:..|.|.....||.....:::|...:     .||:...
Zfish    81 LEDPKETVGQVIIKALSLLYRRCFVIYRYPGKPPTEIAEEDNLPKILLCCSNN-----GHYDIVY 140

  Fly   310 P 310
            |
Zfish   141 P 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 27/126 (21%)
OTU 178..305 CDD:280496 25/124 (20%)
alg13XP_005161471.1 OTU 29..>108 CDD:303090 20/91 (22%)
TUDOR 284..332 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.