DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7857 and YOD1

DIOPT Version :9

Sequence 1:	NP_648769.2	Gene:	CG7857 / 39671	FlyBaseID:	FBgn0026738	Length:	312	Species:	Drosophila melanogaster
Sequence 2:	NP_061036.3	Gene:	YOD1 / 55432	HGNCID:	25035	Length:	348	Species:	Homo sapiens

Alignment Length:	130	Identity:	32/130 - (24%)
Similarity:	54/130 - (41%)	Gaps:	14/130 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   177 IPSDGDCLYQSIRHQLIVNALPGHSVQELREETANYVRAHKDSLISYMIHPETGDILNDQQFEQY 241
            :|:|..||:.|:.:.:....|......|:|...|..|.:..| ..|..|..:|.        ::|
Human   154 VPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVASDPD-FYSEAILGKTN--------QEY 209

  Fly   242 CHDIAKTHAWGGHIELKAISSLLRVPIEVIQAEGAPTLLGQEEFGGSPLIICYHRHIYQLGAHYN 306
            |..|.:...|||.||:..:|...:..|.|:..:........|:.|.:..::.    ||. |.||:
Human   210 CDWIKRDDTWGGAIEISILSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLL----IYD-GIHYD 269

Fly 307 306
Human 270 269

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7857	NP_648769.2	COG5539	17..307	CDD:227826	32/130 (25%)
CG7857	NP_648769.2	OTU	178..305	CDD:280496	30/126 (24%)
YOD1	NP_061036.3	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..39
		UBX-like. /evidence=ECO:0000305\|PubMed:23827681	50..128
		COG5539	91..347	CDD:227826	32/130 (25%)
		Cys-loop. /evidence=ECO:0000305\|PubMed:23827681	154..160		2/5 (40%)
		Variable-loop. /evidence=ECO:0000305\|PubMed:23827681	213..223		4/9 (44%)
		His-loop. /evidence=ECO:0000305\|PubMed:23827681	263..267		2/4 (50%)
		S2 site. /evidence=ECO:0000305\|PubMed:23827681	291..296
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5539
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810