DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7857 and yod1

DIOPT Version :9

Sequence 1:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001017716.1 Gene:yod1 / 550411 ZFINID:ZDB-GENE-050417-217 Length:301 Species:Danio rerio


Alignment Length:201 Identity:45/201 - (22%)
Similarity:79/201 - (39%) Gaps:37/201 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 DKKAKEARAREAEIKTE----LQNAANQPTPKLIELQ------QITAKLSQRQLSLHNIPSDGDC 183
            |.:..||..::..||:.    ::...|:|.|.:....      ::|..:.:|.     :|:|..|
Zfish    54 DLRNGEAHLKDYPIKSGDTLIVEEEKNKPKPPVQPTVTKGPSFEVTPVVERRV-----VPADNSC 113

  Fly   184 LYQSIRHQLIVNALPGHSVQELREETANYVRAHKDSLISYMIHPETGDILNDQQFEQYCHDIAKT 248
            |:.|:.:.:...........|:|...|..| |...:..|..:..:|.        |:||..|.:.
Zfish   114 LFTSVNYVMEGGVYDPACASEMRGLIAQIV-ASDPTAYSEAVLGKTN--------EEYCTWIRRD 169

  Fly   249 HAWGGHIELKAISSLLRVPIEVIQAEGAPTLLGQEEFGGSPLIICYHRHIYQLGAHYN------- 306
            ..|||.||:..:|...:..|.|:..:........|:.|.:..::.    ||. |.||:       
Zfish   170 DTWGGAIEVSILSKFYQCEICVVDTQTVRVDRFGEDAGYTKRVLL----IYD-GIHYDPLQKVLP 229

  Fly   307 -STVPA 311
             |.|||
Zfish   230 GSDVPA 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7857NP_648769.2 COG5539 17..307 CDD:227826 41/195 (21%)
OTU 178..305 CDD:280496 29/126 (23%)
yod1NP_001017716.1 UBX-like 5..83 6/28 (21%)
UBL 5..75 CDD:176364 5/20 (25%)
COG5539 26..300 CDD:227826 45/201 (22%)
Cys-loop. /evidence=ECO:0000250|UniProtKB:Q5VVQ6 107..113 2/5 (40%)
OTU 108..223 CDD:303090 31/128 (24%)
Variable-loop. /evidence=ECO:0000250|UniProtKB:Q5VVQ6 166..176 4/9 (44%)
His-loop. /evidence=ECO:0000250|UniProtKB:Q5VVQ6 216..220 2/4 (50%)
S2 site. /evidence=ECO:0000250|UniProtKB:Q5VVQ6 244..249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.