Sequence 1: | NP_648769.2 | Gene: | CG7857 / 39671 | FlyBaseID: | FBgn0026738 | Length: | 312 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001017716.1 | Gene: | yod1 / 550411 | ZFINID: | ZDB-GENE-050417-217 | Length: | 301 | Species: | Danio rerio |
Alignment Length: | 201 | Identity: | 45/201 - (22%) |
---|---|---|---|
Similarity: | 79/201 - (39%) | Gaps: | 37/201 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 129 DKKAKEARAREAEIKTE----LQNAANQPTPKLIELQ------QITAKLSQRQLSLHNIPSDGDC 183
Fly 184 LYQSIRHQLIVNALPGHSVQELREETANYVRAHKDSLISYMIHPETGDILNDQQFEQYCHDIAKT 248
Fly 249 HAWGGHIELKAISSLLRVPIEVIQAEGAPTLLGQEEFGGSPLIICYHRHIYQLGAHYN------- 306
Fly 307 -STVPA 311 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7857 | NP_648769.2 | COG5539 | 17..307 | CDD:227826 | 41/195 (21%) |
OTU | 178..305 | CDD:280496 | 29/126 (23%) | ||
yod1 | NP_001017716.1 | UBX-like | 5..83 | 6/28 (21%) | |
UBL | 5..75 | CDD:176364 | 5/20 (25%) | ||
COG5539 | 26..300 | CDD:227826 | 45/201 (22%) | ||
Cys-loop. /evidence=ECO:0000250|UniProtKB:Q5VVQ6 | 107..113 | 2/5 (40%) | |||
OTU | 108..223 | CDD:303090 | 31/128 (24%) | ||
Variable-loop. /evidence=ECO:0000250|UniProtKB:Q5VVQ6 | 166..176 | 4/9 (44%) | |||
His-loop. /evidence=ECO:0000250|UniProtKB:Q5VVQ6 | 216..220 | 2/4 (50%) | |||
S2 site. /evidence=ECO:0000250|UniProtKB:Q5VVQ6 | 244..249 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5539 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |